path: root/epan/dissectors/packet-infiniband.c

/* packet-infiniband.c
 * Routines for Infiniband/ERF Dissection
 * Copyright 2008 Endace Technology Limited
 *
 * $Id$
 *
 * Wireshark - Network traffic analyzer
 * By Gerald Combs <gerald@wireshark.org>
 * Copyright 1998 Gerald Combs
 *
 * This program is free software; you can redistribute it and/or
 * modify it under the terms of the GNU General Public License
 * as published by the Free Software Foundation; either version 2
 * of the License, or (at your option) any later version.
 *
 * This program is distributed in the hope that it will be useful,
 * but WITHOUT ANY WARRANTY; without even the implied warranty of
 * MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE.  See the
 * GNU General Public License for more details.
 *
 * You should have received a copy of the GNU General Public License
 * along with this program; if not, write to the Free Software
 * Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA  02111-1307, USA.
 */

#ifdef HAVE_CONFIG_H
# include "config.h"
#endif
#include <stdio.h>
#include <stdlib.h>
#include <string.h>
#include <glib.h>
#include <epan/packet.h>
#include <epan/proto.h>
#include <epan/dissectors/packet-frame.h>
#include "packet-infiniband.h"

/* Main Dissector */
/* Notes: */
/* 1.) Floating "offset+=" statements should probably be "functionized" but they are inline */
/* Offset is only passed by reference in specific places, so do not be confused when following code */
/* In any code path, adding up "offset+=" statements will tell you what byte you are at */
static void
dissect_infiniband(tvbuff_t *tvb, packet_info *pinfo, proto_tree *tree)
{
    /* Top Level Item */
    proto_item *infiniband_packet = NULL;

    /* The Headers Subtree */
    proto_tree *all_headers_tree = NULL;

    /* LRH - Local Route Header */
    proto_tree *local_route_header_tree = NULL;
    proto_item *local_route_header_item = NULL;

    /* GRH - Global Route Header */
    proto_tree *global_route_header_tree = NULL;
    proto_item *global_route_header_item = NULL;

    /* BTH - Base Transport header */
    proto_tree *base_transport_header_tree = NULL;
    proto_item *base_transport_header_item = NULL;

    /* Raw Data */
    proto_tree *RAWDATA_header_tree;
    proto_item *RAWDATA_header_item;
    guint8 lnh_val = 0;             /* Link Next Header Value */
    gint offset = 0;                /* Current Offset */

    /* General Variables */
    gboolean bthFollows = 0;        /* Tracks if we are parsing a BTH.  This is a significant decision point */
    guint8 virtualLane = 0;         /* IB VirtualLane.  Keyed off of for detecting subnet admin/management */
    guint8 opCode = 0;              /* OpCode from BTH header. */
    gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
    guint16 payloadLength = 0;      /* Payload Length should it exist */
    guint8 nxtHdr = 0;              /* Keyed off for header dissection order */
    guint16 packetLength = 0;       /* Packet Length.  We track this as tvb->length - offset.   */
                                    /*  It provides the parsing methods a known size            */
                                    /*   that must be available for that header.                */
    struct e_in6_addr SRCgid;       /* Structures to hold GIDs should we need them */
    struct e_in6_addr DSTgid;
    gint crc_length = 0;

    /* Mark the Packet type as Infiniband in the wireshark UI */
    /* Clear other columns */
    if(pinfo->cinfo)
    {
        col_set_str(pinfo->cinfo, COL_PROTOCOL, "InfiniBand");
        col_clear(pinfo->cinfo, COL_INFO);
    }

    /* Get the parent tree from the ERF dissector.  We don't want to nest under ERF */
    if(tree && tree->parent)
    {
        /* Set the normal tree outside of ERF */
        tree = tree->parent;
        /* Set a global reference for nested protocols */
        top_tree = tree;
    }

    if(!tree)
    {
        /* If no packet details are being dissected, extract some high level info for the packet view */
        /* Assigns column values rather than full tree population */
        dissect_general_info(tvb, offset, pinfo);
        return;
    }

    /* Top Level Packet */
    infiniband_packet = proto_tree_add_item(tree, proto_infiniband, tvb, offset, -1, FALSE);

    /* Headers Level Tree */
    all_headers_tree = proto_item_add_subtree(infiniband_packet, ett_all_headers);

    /* Local Route Header Subtree */
    local_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_LRH, tvb, offset, 8, FALSE);
    proto_item_set_text(local_route_header_item, "%s", "Local Route Header");
    local_route_header_tree = proto_item_add_subtree(local_route_header_item, ett_lrh);

    proto_tree_add_item(local_route_header_tree, hf_infiniband_virtual_lane,            tvb, offset, 1, FALSE);


    /* Get the Virtual Lane.  We'll use this to identify Subnet Management and Subnet Administration Packets. */
    virtualLane =  tvb_get_guint8(tvb, offset);
    virtualLane = virtualLane & 0xF0;


    proto_tree_add_item(local_route_header_tree, hf_infiniband_link_version,            tvb, offset, 1, FALSE); offset+=1;
    proto_tree_add_item(local_route_header_tree, hf_infiniband_service_level,           tvb, offset, 1, FALSE);

    proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved2,               tvb, offset, 1, FALSE);
    proto_tree_add_item(local_route_header_tree, hf_infiniband_link_next_header,        tvb, offset, 1, FALSE);


    /* Save Link Next Header... This tells us what the next header is. */
    lnh_val =  tvb_get_guint8(tvb, offset);
    lnh_val = lnh_val & 0x03;
    offset+=1;


    proto_tree_add_item(local_route_header_tree, hf_infiniband_destination_local_id,    tvb, offset, 2, FALSE);


    /* Set destination in packet view. */
    if (check_col(pinfo->cinfo, COL_DEF_DST))
    {
        col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DLID: %s", tvb_bytes_to_str(tvb, offset, 2));
    }
    offset+=2;


    proto_tree_add_item(local_route_header_tree, hf_infiniband_reserved5,               tvb, offset, 2, FALSE);

    packetLength = tvb_get_ntohs(tvb, offset); /* Get the Packet Length. This will determine payload size later on. */
    packetLength = packetLength & 0x07FF;      /* Mask off top 5 bits, they are reserved */
    packetLength = packetLength * 4;           /* Multiply by 4 to get true byte length. This is by specification.  */
                                               /*   PktLen is size in 4 byte words (byteSize /4). */

    proto_tree_add_item(local_route_header_tree, hf_infiniband_packet_length,           tvb, offset, 2, FALSE); offset+=2;
    proto_tree_add_item(local_route_header_tree, hf_infiniband_source_local_id,         tvb, offset, 2, FALSE);

    /* Set Source in packet view. */
    if (check_col(pinfo->cinfo, COL_DEF_SRC))
    {
        col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SLID: %s", tvb_bytes_to_str(tvb, offset, 2));
    }

    offset+=2;
    packetLength -= 8; /* Shave 8 bytes for the LRH. */

    /* Key off Link Next Header.  This tells us what High Level Data Format we have */
    switch(lnh_val)
    {
        case IBA_GLOBAL:
            global_route_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_GRH, tvb, offset, 40, FALSE);
            proto_item_set_text(global_route_header_item, "%s", "Global Route Header");
            global_route_header_tree = proto_item_add_subtree(global_route_header_item, ett_grh);

            proto_tree_add_item(global_route_header_tree, hf_infiniband_ip_version,         tvb, offset, 1, FALSE);
            proto_tree_add_item(global_route_header_tree, hf_infiniband_traffic_class,      tvb, offset, 2, FALSE);
            proto_tree_add_item(global_route_header_tree, hf_infiniband_flow_label,         tvb, offset, 4, FALSE); offset += 4;

            payloadLength = tvb_get_ntohs(tvb, offset);

            proto_tree_add_item(global_route_header_tree, hf_infiniband_payload_length,     tvb, offset, 2, FALSE); offset += 2;

            nxtHdr = tvb_get_guint8(tvb, offset);

            proto_tree_add_item(global_route_header_tree, hf_infiniband_next_header,        tvb, offset, 1, FALSE); offset +=1;
            proto_tree_add_item(global_route_header_tree, hf_infiniband_hop_limit,          tvb, offset, 1, FALSE); offset +=1;
            proto_tree_add_item(global_route_header_tree, hf_infiniband_source_gid,         tvb, offset, 16, FALSE);

            tvb_get_ipv6(tvb, offset, &SRCgid);
            if (check_col(pinfo->cinfo, COL_DEF_SRC))
            {
                col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SGID: %s", ip6_to_str(&SRCgid));
            }
            offset += 16;

            proto_tree_add_item(global_route_header_tree, hf_infiniband_destination_gid,    tvb, offset, 16, FALSE);

            tvb_get_ipv6(tvb, offset, &DSTgid);
            if (check_col(pinfo->cinfo, COL_DEF_DST))
            {
                col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DGID: %s", ip6_to_str(&DSTgid));
            }
            offset += 16;
            packetLength -= 40; /* Shave 40 bytes for GRH */

            if(nxtHdr != 0x1B)
            {
                /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
                break;
            }
            /* otherwise fall through and start parsing BTH */
        case IBA_LOCAL:
            bthFollows = TRUE;
            base_transport_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_BTH, tvb, offset, 12, FALSE);
            proto_item_set_text(base_transport_header_item, "%s", "Base Transport Header");
            base_transport_header_tree = proto_item_add_subtree(base_transport_header_item, ett_bth);
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_opcode,                       tvb, offset, 1, FALSE);

            /* Get the OpCode - this tells us what headers are following */
            opCode = tvb_get_guint8(tvb, offset);
            if (check_col(pinfo->cinfo, COL_INFO))
            {
                col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
            }
            offset +=1;

            proto_tree_add_item(base_transport_header_tree, hf_infiniband_solicited_event,              tvb, offset, 1, FALSE);
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_migreq,                       tvb, offset, 1, FALSE);
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_pad_count,                    tvb, offset, 1, FALSE);
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_transport_header_version,     tvb, offset, 1, FALSE); offset +=1;
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_partition_key,                tvb, offset, 2, FALSE); offset +=2;
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved8,                    tvb, offset, 1, FALSE); offset +=1;
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_destination_qp,               tvb, offset, 3, FALSE); offset +=3;
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_acknowledge_request,          tvb, offset, 1, FALSE);
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_reserved7,                    tvb, offset, 1, FALSE); offset +=1;
            proto_tree_add_item(base_transport_header_tree, hf_infiniband_packet_sequence_number,       tvb, offset, 3, FALSE); offset +=3;


            packetLength -= 12; /* Shave 12 for Base Transport Header */

        break;
        case IP_NON_IBA:
            /* Raw IPv6 Packet */
            if (check_col(pinfo->cinfo, COL_DEF_DST))
            {
                col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
                col_set_fence(pinfo->cinfo, COL_DEF_DST);
            }
            parse_IPvSix(all_headers_tree, tvb, &offset, pinfo);
            break;
        case RAW:
            parse_RWH(all_headers_tree, tvb, &offset, pinfo);
            break;
        default:
            /* Unknown Packet */
            RAWDATA_header_item = proto_tree_add_item(all_headers_tree, hf_infiniband_raw_data, tvb, offset, -1, FALSE);
            proto_item_set_text(RAWDATA_header_item, "%s", "Unknown Raw Data - IB Encapsulated");
            RAWDATA_header_tree = proto_item_add_subtree(RAWDATA_header_item, ett_rawdata);
            break;
    }

    /* Base Transport header is hit quite often, however it is alone since it is the exception not the rule */
    /* Only IBA Local packets use it */
    if(bthFollows)
    {
        /* Find our next header sequence based on the Opcode
        * Each case decrements the packetLength by the amount of bytes consumed by each header.
        * The find_next_header_sequence method could be used to automate this.
        * We need to keep track of this so we know much data to mark as payload/ICRC/VCRC values. */

        nextHeaderSequence = find_next_header_sequence((guint32) opCode);

        /* find_next_header_sequence gives us the DEFINE value corresponding to the header order following */
        /* Enumerations are named intuitively, e.g. RDETH DETH PAYLOAD means there is an RDETH Header, DETH Header, and a packet payload */
        switch(nextHeaderSequence)
        {
            case RDETH_DETH_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_DETH_RETH_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_RETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */
                packetLength -= 16; /* RETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_DETH_IMMDT_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_IMMDT(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */
                packetLength -= 4; /* IMMDT */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_DETH_RETH_IMMDT_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_RETH(all_headers_tree, tvb, &offset);
                parse_IMMDT(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */
                packetLength -= 16; /* RETH */
                packetLength -= 4; /* IMMDT */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_DETH_RETH:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_RETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */
                packetLength -= 16; /* RETH */

                break;
            case RDETH_AETH_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_AETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 4; /* AETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_PAYLD:
                parse_RDETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RDETH_AETH:
                parse_AETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 4; /* AETH */


                break;
            case RDETH_AETH_ATOMICACKETH:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_AETH(all_headers_tree, tvb, &offset);
                parse_ATOMICACKETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 4; /* AETH */
                packetLength -= 8; /* AtomicAckETH */


                break;
            case RDETH_DETH_ATOMICETH:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_ATOMICETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */
                packetLength -= 28; /* AtomicETH */

                break;
            case RDETH_DETH:
                parse_RDETH(all_headers_tree, tvb, &offset);
                parse_DETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* RDETH */
                packetLength -= 8; /* DETH */

                break;
            case DETH_PAYLD:
                parse_DETH(all_headers_tree, tvb, &offset);

                packetLength -= 8; /* DETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case PAYLD:

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case IMMDT_PAYLD:
                parse_IMMDT(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* IMMDT */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RETH_PAYLD:
                parse_RETH(all_headers_tree, tvb, &offset);

                packetLength -= 16; /* RETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case RETH:
                parse_RETH(all_headers_tree, tvb, &offset);

                packetLength -= 16; /* RETH */

                break;
            case AETH_PAYLD:
                parse_AETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* AETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case AETH:
                parse_AETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* AETH */

                break;
            case AETH_ATOMICACKETH:
                parse_AETH(all_headers_tree, tvb, &offset);
                parse_ATOMICACKETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* AETH */
                packetLength -= 8; /* AtomicAckETH */

                break;
            case ATOMICETH:
                parse_ATOMICETH(all_headers_tree, tvb, &offset);

                packetLength -= 28; /* AtomicETH */

                break;
            case IETH_PAYLD:
                parse_IETH(all_headers_tree, tvb, &offset);

                packetLength -= 4; /* IETH */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            case DETH_IMMDT_PAYLD:
                parse_DETH(all_headers_tree, tvb, &offset);
                parse_IMMDT(all_headers_tree, tvb, &offset);

                packetLength -= 8; /* DETH */
                packetLength -= 4; /* IMMDT */

                parse_PAYLOAD(all_headers_tree, pinfo, tvb, &offset, packetLength, virtualLane);
                break;
            default:
                parse_VENDOR(all_headers_tree, tvb, &offset);
                break;

        }

    }
    /* Display the ICRC/VCRC */
    /* Doing it this way rather than in a variety of places according to the specific packet */
    /* If we've already displayed it crc_length comes out 0 */
    crc_length = tvb_reported_length_remaining(tvb, offset);
    if(crc_length == 6)
    {
        proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
        proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc,   tvb, offset, 2, FALSE); offset+=2;
    }
    else if(crc_length == 4)
    {
        proto_tree_add_item(all_headers_tree, hf_infiniband_invariant_crc, tvb, offset, 4, FALSE); offset +=4;
    }
    else if(crc_length == 2)
    {
        proto_tree_add_item(all_headers_tree, hf_infiniband_variant_crc,   tvb, offset, 2, FALSE); offset+=2;
    }
    
}

/* Description: Finds the header sequence that follows the Base Transport Header.
* Somwhat inefficient (should be using a single key,value pair data structure)
* But uses pure probablity to take a stab at better efficiency.
* Searches largest header sequence groups first, and then finally resorts to single matches for unique header sequences
* IN: OpCode: The OpCode from the Base Transport Header.
* OUT: The Header Sequence enumeration.  See Declarations for #defines from (0-22) */
static gint32
find_next_header_sequence(guint32 OpCode)
{
    if(contains(OpCode, &opCode_PAYLD[0], (gint32)sizeof(opCode_PAYLD)))
        return PAYLD;

    if(contains(OpCode, &opCode_IMMDT_PAYLD[0], (gint32)sizeof(opCode_IMMDT_PAYLD)))
        return IMMDT_PAYLD;

    if(contains(OpCode, &opCode_RDETH_DETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_PAYLD)))
        return RDETH_DETH_PAYLD;

    if(contains(OpCode, &opCode_RETH_PAYLD[0], (gint32)sizeof(opCode_RETH_PAYLD)))
        return RETH_PAYLD;

    if(contains(OpCode, &opCode_RDETH_AETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_AETH_PAYLD)))
        return RDETH_AETH_PAYLD;

    if(contains(OpCode, &opCode_AETH_PAYLD[0], (gint32)sizeof(opCode_AETH_PAYLD)))
        return AETH_PAYLD;

    if(contains(OpCode, &opCode_RDETH_DETH_IMMDT_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_IMMDT_PAYLD)))
        return RDETH_DETH_IMMDT_PAYLD;

    if(contains(OpCode, &opCode_RETH_IMMDT_PAYLD[0], (gint32)sizeof(opCode_RETH_IMMDT_PAYLD)))
        return RETH_IMMDT_PAYLD;

    if(contains(OpCode, &opCode_RDETH_DETH_RETH_PAYLD[0], (gint32)sizeof(opCode_RDETH_DETH_RETH_PAYLD)))
        return RDETH_DETH_RETH_PAYLD;

    if(contains(OpCode, &opCode_ATOMICETH[0], (gint32)sizeof(opCode_ATOMICETH)))
        return ATOMICETH;

    if(contains(OpCode, &opCode_IETH_PAYLD[0], (gint32)sizeof(opCode_IETH_PAYLD)))
        return IETH_PAYLD;

    if(contains(OpCode, &opCode_RDETH_DETH_ATOMICETH[0], (gint32)sizeof(opCode_RDETH_DETH_ATOMICETH)))
        return RDETH_DETH_ATOMICETH;

    if((OpCode ^ RC_ACKNOWLEDGE) == 0)
        return AETH;

    if((OpCode ^ RC_RDMA_READ_REQUEST) == 0)
        return RETH;

    if((OpCode ^ RC_ATOMIC_ACKNOWLEDGE) == 0)
        return AETH_ATOMICACKETH;

    if((OpCode ^ RD_RDMA_READ_RESPONSE_MIDDLE) == 0)
        return RDETH_PAYLD;

    if((OpCode ^ RD_ACKNOWLEDGE) == 0)
        return RDETH_AETH;

    if((OpCode ^ RD_ATOMIC_ACKNOWLEDGE) == 0)
        return RDETH_AETH_ATOMICACKETH;

    if((OpCode ^ RD_RDMA_WRITE_ONLY_IMM) == 0)
        return RDETH_DETH_RETH_IMMDT_PAYLD;

    if((OpCode ^ RD_RDMA_READ_REQUEST) == 0)
        return RDETH_DETH_RETH;

    if((OpCode ^ RD_RESYNC) == 0)
        return RDETH_DETH;

    if((OpCode ^ UD_SEND_ONLY) == 0)
        return DETH_PAYLD;

    if((OpCode ^ UD_SEND_ONLY_IMM) == 0)
        return DETH_IMMDT_PAYLD;

    return -1;
}

/* Description: Finds if a given value is present in an array. This is probably in a standard library somewhere,
* But I'd rather define my own.
* IN: OpCode: The OpCode you are looking for
* IN: Codes: The organized array of OpCodes to look through
* IN: Array length, because we're in C++...
* OUT: Boolean indicating if that OpCode was found in OpCodes */
static gboolean
contains(guint32 OpCode, guint32* Codes, gint32 length)
{
    gint32 i;
    for(i = 0; i < length; i++)
    {
        if((OpCode ^ Codes[i]) == 0)
            return TRUE;
    }
    return FALSE;
}

/* Parse RDETH - Reliable Datagram Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_RDETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* RDETH - Reliable Datagram Extended Transport Header */
    proto_tree *RDETH_header_tree = NULL;
    proto_item *RDETH_header_item = NULL;

    RDETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RDETH, tvb, local_offset, 4, FALSE);
    proto_item_set_text(RDETH_header_item, "%s", "RDETH - Reliable Datagram Extended Transport Header");
    RDETH_header_tree = proto_item_add_subtree(RDETH_header_item, ett_rdeth);

    proto_tree_add_item(RDETH_header_tree, hf_infiniband_reserved8_RDETH,   tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(RDETH_header_tree, hf_infiniband_ee_context,        tvb, local_offset, 3, FALSE); local_offset+=3;
    *offset = local_offset;
}

/* Parse DETH - Datagram Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_DETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* DETH - Datagram Extended Transport Header */
    proto_tree *DETH_header_tree = NULL;
    proto_item *DETH_header_item = NULL;

    DETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_DETH, tvb, local_offset, 8, FALSE);
    proto_item_set_text(DETH_header_item, "%s", "DETH - Datagram Extended Transport Header");
    DETH_header_tree = proto_item_add_subtree(DETH_header_item, ett_deth);

    proto_tree_add_item(DETH_header_tree, hf_infiniband_queue_key,                  tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(DETH_header_tree, hf_infiniband_reserved8_DETH,             tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(DETH_header_tree, hf_infiniband_source_qp,                  tvb, local_offset, 3, FALSE); local_offset+=3;

    *offset = local_offset;
}

/* Parse RETH - RDMA Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_RETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* RETH - RDMA Extended Transport Header */
    proto_tree *RETH_header_tree = NULL;
    proto_item *RETH_header_item = NULL;

    RETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_RETH, tvb, local_offset, 16, FALSE);
    proto_item_set_text(RETH_header_item, "%s", "RETH - RDMA Extended Transport Header");
    RETH_header_tree = proto_item_add_subtree(RETH_header_item, ett_reth);

    proto_tree_add_item(RETH_header_tree, hf_infiniband_virtual_address,                tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(RETH_header_tree, hf_infiniband_remote_key,                     tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(RETH_header_tree, hf_infiniband_dma_length,                     tvb, local_offset, 4, FALSE); local_offset+=4;

    *offset = local_offset;
}

/* Parse AtomicETH - Atomic Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_ATOMICETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* AtomicETH - Atomic Extended Transport Header */
    proto_tree *ATOMICETH_header_tree = NULL;
    proto_item *ATOMICETH_header_item = NULL;

    ATOMICETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicETH, tvb, local_offset, 28, FALSE);
    proto_item_set_text(ATOMICETH_header_item, "%s", "AtomicETH - Atomic Extended Transport Header");
    ATOMICETH_header_tree = proto_item_add_subtree(ATOMICETH_header_item, ett_atomiceth);

    proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_virtual_address,               tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_remote_key,                    tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_swap_or_add_data,              tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(ATOMICETH_header_tree, hf_infiniband_compare_data,                  tvb, local_offset, 8, FALSE); local_offset+=8;
    *offset = local_offset;
}

/* Parse AETH - ACK Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_AETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* AETH - ACK Extended Transport Header */
    proto_tree *AETH_header_tree = NULL;
    proto_item *AETH_header_item = NULL;

    AETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AETH, tvb, local_offset, 4, FALSE);
    proto_item_set_text(AETH_header_item, "%s", "AETH - ACK Extended Transport Header");
    AETH_header_tree = proto_item_add_subtree(AETH_header_item, ett_aeth);

    proto_tree_add_item(AETH_header_tree, hf_infiniband_syndrome,                       tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(AETH_header_tree, hf_infiniband_message_sequence_number,        tvb, local_offset, 3, FALSE); local_offset+=3;

    *offset = local_offset;
}

/* Parse AtomicAckEth - Atomic ACK Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_ATOMICACKETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* AtomicAckEth - Atomic ACK Extended Transport Header */
    proto_tree *ATOMICACKETH_header_tree = NULL;
    proto_item *ATOMICACKETH_header_item = NULL;

    ATOMICACKETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_AtomicAckETH, tvb, local_offset, 8, FALSE);
    proto_item_set_text(ATOMICACKETH_header_item, "%s", "ATOMICACKETH - Atomic ACK Extended Transport Header");
    ATOMICACKETH_header_tree = proto_item_add_subtree(ATOMICACKETH_header_item, ett_atomicacketh);
    proto_tree_add_item(ATOMICACKETH_header_tree, hf_infiniband_original_remote_data,   tvb, local_offset, 8, FALSE); local_offset+=8;
    *offset = local_offset;
}

/* Parse IMMDT - Immediate Data Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_IMMDT(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* IMMDT - Immediate Data Extended Transport Header */
    proto_tree *IMMDT_header_tree = NULL;
    proto_item *IMMDT_header_item = NULL;

    IMMDT_header_item = proto_tree_add_item(parentTree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE);
    proto_item_set_text(IMMDT_header_item, "%s", "IMMDT - Immediate Data Extended Transport Header");
    IMMDT_header_tree = proto_item_add_subtree(IMMDT_header_item, ett_immdt);
    proto_tree_add_item(IMMDT_header_tree, hf_infiniband_IMMDT, tvb, local_offset, 4, FALSE); local_offset+=4;
    *offset = local_offset;
}

/* Parse IETH - Invalidate Extended Transport Header
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void
parse_IETH(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    /* IETH - Invalidate Extended Transport Header */
    proto_tree *IETH_header_tree = NULL;
    proto_item *IETH_header_item = NULL;

    IETH_header_item = proto_tree_add_item(parentTree, hf_infiniband_IETH, tvb, local_offset, 4, FALSE);
    proto_item_set_text(IETH_header_item, "%s", "IETH - Invalidate Extended Transport Header");
    IETH_header_tree = proto_item_add_subtree(IETH_header_item, ett_ieth);

    proto_tree_add_item(IETH_header_tree, hf_infiniband_IETH,   tvb, local_offset, 4, FALSE); local_offset+=4;

    *offset = local_offset;
}

/* Parse Payload - Packet Payload / Invariant CRC / Variant CRC
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: pinfo - packet info from wireshark
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset
* IN: Length of Payload */
static void parse_PAYLOAD(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset, gint length, guint8 virtualLane)
{
    gint local_offset = *offset;
    /* Payload - Packet Payload */
    proto_tree *PAYLOAD_header_tree = NULL;
    proto_item *PAYLOAD_header_item = NULL;
    guint8 management_class;
    tvbuff_t *volatile next_tvb;
    gint            captured_length, reported_length;
    guint16 etype, reserved;
    const char      *saved_proto;
    volatile gboolean   dissector_found = FALSE;
 
    if(!tvb_bytes_exist(tvb, *offset, length)) /* previously consumed bytes + offset was all the data - none or corrupt payload */
    {
        if (check_col(pinfo->cinfo, COL_INFO))
        {
            col_set_str(pinfo->cinfo, COL_INFO, "Invalid Packet Length from LRH! [Malformed Packet]");
            col_set_fence(pinfo->cinfo, COL_INFO);
        }
        return;
    }
    if(virtualLane == 0xF0)
    {
        management_class =  tvb_get_guint8(tvb, (*offset) + 1);

        if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
            || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
        {
            /* parse vendor specific */
            parse_VENDOR_MANAGEMENT(parentTree, tvb, offset);
        }
        else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
        {
            /* parse application specific */
            parse_APPLICATION_MANAGEMENT(parentTree, tvb, offset);
        }
        else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
            || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
            || ((management_class >= (guint8)0x82)))
        {
            /* parse reserved classes */
            parse_RESERVED_MANAGEMENT(parentTree, tvb, offset);
        }
        else /* we have a normal management_class */
        {
            switch(management_class)
            {
                case SUBN_LID_ROUTED:
                    /* parse subn man lid routed */
                    parse_SUBN_LID_ROUTED(parentTree, pinfo, tvb, &local_offset);
                break;
                case SUBN_DIRECTED_ROUTE:
                    /* parse subn directed route */
                    parse_SUBN_DIRECTED_ROUTE(parentTree, pinfo, tvb, &local_offset);
                break;
                case SUBNADMN:
                    /* parse sub admin */
                    parse_SUBNADMN(parentTree, pinfo, tvb, &local_offset);
                break;
                case PERF:
                    /* parse performance */
                    parse_PERF(parentTree, tvb, &local_offset);
                break;
                case BM:
                    /* parse baseboard mgmt */
                    parse_BM(parentTree, tvb, &local_offset);
                break;
                case DEV_MGT:
                    /* parse device management */
                    parse_DEV_MGT(parentTree, tvb, &local_offset);
                break;
                case COM_MGT:
                    /* parse communication management */
                    parse_COM_MGT(parentTree, tvb, &local_offset);
                break;
                case SNMP:
                    /* parse snmp tunneling */
                    parse_SNMP(parentTree, tvb, &local_offset);
                break;
                default:
                    break;
            }
        }
    }
    else /* Normal Data Packet - Parse as such */
    {

        /* Calculation for Payload:
        * (tvb->length) Length of entire packet - (local_offset) Starting byte of Payload Data
        * offset addition is more complex for the payload.
        * We need the total length of the packet, - length of previous headers, + offset where payload started.
        * We also need  to reserve 6 bytes for the CRCs which are not actually part of the payload.  */

        /* IBA packet data could be anything in principle, however it is common
         * practice to carry non-IBA data encapsulated with an EtherType header,
         * similar to the RWH header. There is no way to identify these frames
         * positively.
         *
         * We see if the first few bytes look like an EtherType header, and if so
         * call the appropriate dissector. If not we call the "data" dissector.
         */

        etype = tvb_get_ntohs(tvb, local_offset);
        reserved =  tvb_get_ntohs(tvb, local_offset + 2);

        if (reserved == 0) {
            
            /* Get the captured length and reported length of the data
               after the Ethernet type. */
            captured_length = tvb_length_remaining(tvb, local_offset+4);
            reported_length = tvb_reported_length_remaining(tvb,
                                    local_offset+4);
            
            next_tvb = tvb_new_subset(tvb, local_offset+4, captured_length,
                          reported_length);
            
            pinfo->ethertype = etype;
            
            /* Look for sub-dissector, and call it if found.
               Catch exceptions, so that if the reported length of "next_tvb"
               was reduced by some dissector before an exception was thrown,
               we can still put in an item for the trailer. */
            saved_proto = pinfo->current_proto;
            TRY {
                dissector_found = dissector_try_port(ethertype_dissector_table,
                                     etype, next_tvb, pinfo, top_tree);
            }
            CATCH(BoundsError) {
                /* Somebody threw BoundsError, which means that:
                   
                1) a dissector was found, so we don't need to
                dissect the payload as data or update the
                protocol or info columns;
                
                2) dissecting the payload found that the packet was
                cut off by a snapshot length before the end of
                the payload.  The trailer comes after the payload,
                so *all* of the trailer is cut off, and we'll
                just get another BoundsError if we add the trailer.
                
                Therefore, we just rethrow the exception so it gets
                reported; we don't dissect the trailer or do anything
                else. */
                RETHROW;
            }
            CATCH(OutOfMemoryError) {
                RETHROW;
            }
            CATCH_ALL {
                /* Somebody threw an exception other than BoundsError, which
                   means that a dissector was found, so we don't need to
                   dissect the payload as data or update the protocol or info
                   columns.  We just show the exception and then drive on
                   to show the trailer, after noting that a dissector was
                   found and restoring the protocol value that was in effect
                   before we called the subdissector. */
                show_exception(next_tvb, pinfo, top_tree, EXCEPT_CODE, GET_MESSAGE);
                dissector_found = TRUE;
                pinfo->current_proto = saved_proto;
            }
            ENDTRY;
            
            if (dissector_found) {
                /* now create payload entry to show Ethertype */
                PAYLOAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_payload, tvb, local_offset, tvb_reported_length_remaining(tvb, local_offset)-6, FALSE);
                proto_item_set_text(PAYLOAD_header_item, "%s", "IBA Payload - appears to be EtherType encapsulated"); 
                PAYLOAD_header_tree = proto_item_add_subtree(PAYLOAD_header_item, ett_payload);
                proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_etype, tvb,
                            local_offset, 2,  tvb_get_ntohs(tvb, local_offset));

                local_offset += 2;

                proto_tree_add_uint(PAYLOAD_header_tree, hf_infiniband_reserved16_RWH, tvb,
                            local_offset, 2, tvb_get_ntohs(tvb, local_offset));

            }
                
        }
        
        if (!dissector_found) {
            /* No sub-dissector found.
               Label rest of packet as "Data" */
            
            captured_length = tvb_length_remaining(tvb, local_offset);
            reported_length = tvb_reported_length_remaining(tvb,
                                    local_offset);
            
            if (reported_length >= 6)
                reported_length -= 6;
            if (captured_length > reported_length)
                captured_length = reported_length;

            next_tvb = tvb_new_subset(tvb, local_offset,
                          captured_length,
                          reported_length);
            
            call_dissector(data_handle, next_tvb, pinfo, top_tree);
            
        }
        

        /*parse_RWH(parentTree, tvb, &local_offset, pinfo);*/
        
        /* Will contain ICRC and VCRC = 4+2 */
        local_offset = tvb_reported_length(tvb) - 6;
    }

    *offset = local_offset;
}

/* Parse VENDOR - Parse a vendor specific or unknown header sequence
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_VENDOR(proto_tree * parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *VENDOR_header_tree = NULL;
    proto_item *VENDOR_header_item = NULL;

    VENDOR_header_item = proto_tree_add_item(parentTree, hf_infiniband_vendor, tvb, local_offset, 4, FALSE);
    proto_item_set_text(VENDOR_header_item, "%s", "Vendor Specific or Unknown Header Sequence");
    VENDOR_header_tree = proto_item_add_subtree(VENDOR_header_item, ett_vendor);
    proto_tree_add_item(VENDOR_header_tree, hf_infiniband_vendor,   tvb, local_offset, -1, FALSE);
    *offset = local_offset;
}

/* Parse IPv6 - Parse an IPv6 Packet
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset
* IN: pinfo - packet info from wireshark */
static void parse_IPvSix(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
{
    tvbuff_t *ipv6_tvb;

    /* (- 2) for VCRC which lives at the end of the packet   */
    ipv6_tvb = tvb_new_subset(tvb, *offset,
                  tvb_length_remaining(tvb, *offset) - 2,
                  tvb_reported_length_remaining(tvb, *offset) - 2);
    call_dissector(ipv6_handle, ipv6_tvb, pinfo, parentTree);
    *offset = tvb_reported_length(tvb) - 2;

    /* Display the VCRC */
    proto_tree_add_item(parentTree, hf_infiniband_variant_crc,  tvb, *offset, 2, FALSE);
}

/* Parse EtherType - Parse a generic IP packaet with an EtherType of IP or ARP
* IN: parentTree to add the dissection to - in this code the all_headers_tree
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset
* IN: pinfo - packet info from wireshark */
static void parse_RWH(proto_tree *ah_tree, tvbuff_t *tvb, gint *offset, packet_info *pinfo)
{
    guint16 ether_type;
    tvbuff_t *next_tvb;

    /* RWH - Raw Header */
    proto_tree *RWH_header_tree = NULL;
    proto_item *RWH_header_item = NULL;

    gint captured_length, reported_length;
    
    RWH_header_item = proto_tree_add_item(ah_tree, hf_infiniband_RWH, tvb, *offset, 4, FALSE);
    proto_item_set_text(RWH_header_item, "%s", "RWH - Raw Header");
    RWH_header_tree = proto_item_add_subtree(RWH_header_item, ett_rwh);

    ether_type = tvb_get_ntohs(tvb, *offset);
#if 0
    ether_type = ether_type & 0x0F; /* mask off reserved bits just in case. */
#endif
    proto_tree_add_uint(RWH_header_tree, hf_infiniband_etype, tvb, *offset, 2,
                        ether_type);
    *offset += 2;

    proto_tree_add_item(RWH_header_tree, hf_infiniband_reserved16_RWH, tvb,
            *offset, 2, FALSE);

    *offset += 2;

    /* Get the captured length and reported length of the data
     * after the Ethernet type. */
    captured_length = tvb_length_remaining(tvb, *offset);
    reported_length = tvb_reported_length_remaining(tvb, *offset);

    /* Construct a tvbuff for the payload after the Ethernet type,
     * not including the FCS. */
    if (captured_length >= 0 && reported_length >= 0) {
        if (reported_length >= 2)
            reported_length -= 2;
        if (captured_length > reported_length)
            captured_length = reported_length;
    }

    next_tvb = tvb_new_subset(tvb, *offset, captured_length, reported_length);
    if (!dissector_try_port(ethertype_dissector_table, ether_type,
            next_tvb, pinfo, top_tree))
       call_dissector(data_handle, next_tvb, pinfo, top_tree);

    *offset = tvb_reported_length(tvb) - 2;
    /* Display the VCRC */
    proto_tree_add_item(ah_tree, hf_infiniband_variant_crc, tvb, *offset, 2, FALSE);
}

/* Parse Subnet Management (LID Routed)
* IN: parentTree to add the dissection to
* IN: pinfo - packet info from wireshark
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_SUBN_LID_ROUTED(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_tree *SUBN_LID_ROUTED_header_tree = NULL;
    proto_item *SUBN_LID_ROUTED_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }

    local_offset = *offset;

    /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section. */
    SUBN_LID_ROUTED_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_LID, tvb, local_offset - 24, 256, FALSE);
    proto_item_set_text(SUBN_LID_ROUTED_header_item, "%s", "SMP (LID Routed) ");
    SUBN_LID_ROUTED_header_tree = proto_item_add_subtree(SUBN_LID_ROUTED_header_item, ett_subn_lid_routed);
    proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_m_key,           tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved256,     tvb, local_offset, 32, FALSE); local_offset +=32;

    label_SUBM_Method(SUBN_LID_ROUTED_header_item, &MadData, pinfo);
    label_SUBM_Attribute(SUBN_LID_ROUTED_header_item, &MadData, pinfo);

    /* Try to do the detail parse of the attribute.  If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
    if(!parse_SUBM_Attribute(SUBN_LID_ROUTED_header_tree, tvb, &local_offset, &MadData))
    {
        proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_smp_data,    tvb, local_offset, 64, FALSE); local_offset +=64;
    }

    proto_tree_add_item(SUBN_LID_ROUTED_header_tree, hf_infiniband_reserved1024,    tvb, local_offset, 128, FALSE); local_offset +=128;
    *offset = local_offset;
}

/* Parse Subnet Management (Directed Route)
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_SUBN_DIRECTED_ROUTE(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_tree *SUBN_DIRECTED_ROUTE_header_tree = NULL;
    proto_item *SUBN_DIRECTED_ROUTE_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }

    local_offset = *offset;

    /* local_offset - 24 here because when we come out of parse_MAD_Common, the offset it sitting at the data section.
    * We need to go backwards because this particular SMP uses the class specific portion of the Common MAD Header */
    SUBN_DIRECTED_ROUTE_header_item = proto_tree_add_item(parentTree, hf_infiniband_SMP_DIRECTED, tvb, local_offset - 24, 256, FALSE);
    proto_item_set_text(SUBN_DIRECTED_ROUTE_header_item, "%s", "SMP (Directed Route) ");
    SUBN_DIRECTED_ROUTE_header_tree = proto_item_add_subtree(SUBN_DIRECTED_ROUTE_header_item, ett_subn_directed_route);

    label_SUBM_Method(SUBN_DIRECTED_ROUTE_header_item, &MadData, pinfo);
    label_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_item, &MadData, pinfo);

    /* Place us at offset 4, the "D" Bit (Direction bit for Directed Route SMPs) */
    local_offset -= 20;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_d,               tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_status,      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_pointer,     tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_hop_count,       tvb, local_offset, 1, FALSE); local_offset +=1;
    local_offset += 16; /* Skip over the rest of the Common MAD Header... It's already dissected by parse_MAD_Common */
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_m_key,           tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_slid,         tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_dr_dlid,         tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_reserved28,      tvb, local_offset, 28, FALSE); local_offset +=28;

    /* Try to do the detail parse of the attribute.  If there is an error, or the attribute is unknown, we'll just highlight the generic data. */
    if(!parse_SUBM_Attribute(SUBN_DIRECTED_ROUTE_header_tree, tvb, &local_offset, &MadData))
    {
        proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_smp_data,    tvb, local_offset, 64, FALSE); local_offset +=64;
    }

    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_initial_path,        tvb, local_offset, 64, FALSE); local_offset +=64;
    proto_tree_add_item(SUBN_DIRECTED_ROUTE_header_tree, hf_infiniband_return_path,     tvb, local_offset, 64, FALSE); local_offset +=64;
    *offset = local_offset;
}

/* Parse Subnet Administration
* IN: parentTree to add the dissection to
* IN: pinfo - packet info from wireshark
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_SUBNADMN(proto_tree *parentTree, packet_info *pinfo, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_tree *SUBNADMN_header_tree = NULL;
    proto_item *SUBNADMN_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    if(!parse_RMPP(parentTree, tvb, offset))
    {
        /* TODO: Mark Corrupt Packet */
        return;
    }
    local_offset = *offset;

    SUBNADMN_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset - 36, 256, FALSE);
    proto_item_set_text(SUBNADMN_header_item, "%s", "SMA");
    SUBNADMN_header_tree = proto_item_add_subtree(SUBNADMN_header_item, ett_subnadmin);

    proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_sm_key,             tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_attribute_offset,   tvb, local_offset, 2, FALSE); local_offset+=4;
    proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_reserved16,         tvb, local_offset, 2, FALSE); local_offset+=4;
    proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_component_mask,     tvb, local_offset, 8, FALSE); local_offset+=8;

    label_SUBA_Method(SUBNADMN_header_item, &MadData, pinfo);
    label_SUBA_Attribute(SUBNADMN_header_item, &MadData, pinfo);

    if(!parse_SUBA_Attribute(SUBNADMN_header_tree, tvb, &local_offset, &MadData))
    {
        proto_tree_add_item(SUBNADMN_header_tree, hf_infiniband_subnet_admin_data,  tvb, local_offset, 200, FALSE); local_offset+=200;
    }
    *offset = local_offset;
}

/* Parse Performance Management
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_PERF(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;
    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "PERF - Performance Management MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Baseboard Management
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_BM(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;

    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "BM - Baseboard Management MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Device Management
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_DEV_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;
    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "DEV_MGT - Device Management MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Communications Management
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_COM_MGT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;
    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "COMM - Communication Management MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse SNMP Tunneling
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_SNMP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
        /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;

    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "SNMP - SNMP Tunneling MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Vendor Specific Management Packets
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_VENDOR_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;

    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "VENDOR - Vendor Specific Management MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Application Specific Management Packets
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_APPLICATION_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;
    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "APP - Application Specific MAD (Dissector Not Implemented)");
    *offset = local_offset;
}

/* Parse Reserved Management Packets.

* This is an !ERROR CONDITION!
* It means that the Management Class value used was defined as a reserved value for furture use.
* This method is here since we will want to report this information directly to the UI without blowing up Wireshark.

* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static void parse_RESERVED_MANAGEMENT(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    /* Parse the Common MAD Header */
    MAD_Data MadData;
    gint local_offset;
    proto_item *PERF_header_item = NULL;

    if(!parse_MAD_Common(parentTree, tvb, offset, &MadData))
    {
        /* TODO: Mark Corrupt Packet - Not enough bytes exist for at least the Common MAD header which is present in all MAD packets */
        return;
    }
    local_offset = *offset;
    PERF_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 256, FALSE); local_offset += 256;
    proto_item_set_text(PERF_header_item, "%s", "RESERVED - Reserved MAD Type (Possible Device Error)");
    *offset = local_offset;
}

/* Parse the common MAD Header
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset
* IN/OUT: MadData - the data from the MAD header */
static gboolean parse_MAD_Common(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data* MadData)
{
    gint local_offset = *offset;
    proto_tree *MAD_header_tree = NULL;
    proto_item *MAD_header_item = NULL;

    if(MadData == NULL)
        return FALSE;
    if(!tvb_bytes_exist(tvb, *offset, 256))
        return FALSE;

    /* Get the Management Class to decide between LID Routed and Direct Route */
    MadData->managementClass =      tvb_get_guint8(tvb, local_offset + 1);
    MadData->classVersion =         tvb_get_guint8(tvb, local_offset + 2);
    MadData->method =               tvb_get_guint8(tvb, local_offset + 3);
    MadData->status =               tvb_get_guint8(tvb, local_offset + 4);
    MadData->classSpecific =        tvb_get_ntohs(tvb, local_offset + 6);
    MadData->transactionID =        tvb_get_ntoh64(tvb, local_offset + 8);
    MadData->attributeID =          tvb_get_ntohs(tvb, local_offset + 16);
    MadData->attributeModifier =    tvb_get_ntohl(tvb, local_offset + 20);
    tvb_memcpy(tvb, MadData->data, local_offset + 24, 232);

    /* Populate the Dissector Tree */

    MAD_header_item = proto_tree_add_item(parentTree, hf_infiniband_MAD, tvb, local_offset, 256, FALSE);
    proto_item_set_text(MAD_header_item, "%s", "MAD Header - Common Management Datagram");
    MAD_header_tree = proto_item_add_subtree(MAD_header_item, ett_mad);

    proto_tree_add_item(MAD_header_tree, hf_infiniband_base_version,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_mgmt_class,          tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_class_version,       tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_method,              tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_status,              tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_class_specific,      tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_transaction_id,      tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_id,        tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_reserved16,          tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_attribute_modifier,  tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(MAD_header_tree, hf_infiniband_data,                tvb, local_offset, 232, FALSE); local_offset+=232;
    *offset = (local_offset - 232); /* Move the offset back to the start of the Data field - this will be where the other parsers start. */

    return TRUE;
}

/* Parse the RMPP (Reliable Multi-Packet Transaction Protocol
* IN: parentTree to add the dissection to
* IN: tvb - the data buffer from wireshark
* IN/OUT: The current and updated offset */
static gboolean parse_RMPP(proto_tree *parentTree, tvbuff_t *tvb, gint *offset)
{
    gint local_offset = *offset;
    guint8 RMPP_Type = tvb_get_guint8(tvb, local_offset + 1);
    proto_tree *RMPP_header_tree = NULL;
    proto_item *RMPP_header_item = NULL;

    RMPP_header_item = proto_tree_add_item(parentTree, hf_infiniband_RMPP, tvb, local_offset, 12, FALSE);
    proto_item_set_text(RMPP_header_item, "%s", val_to_str(RMPP_Type, RMPP_Packet_Types, "Reserved RMPP Type! (0x%02x)"));
    RMPP_header_tree = proto_item_add_subtree(RMPP_header_item, ett_rmpp);

    proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_version,   tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_type,      tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(RMPP_header_tree, hf_infiniband_r_resp_time,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_flags,     tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_status,    tvb, local_offset, 1, FALSE); local_offset+=1;
    switch(RMPP_Type)
    {
        case RMPP_ILLEGAL:
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data1,     tvb, local_offset, 32, FALSE); local_offset+=32;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_rmpp_data2,     tvb, local_offset, 32, FALSE); local_offset+=32;
            break;
        case RMPP_DATA:
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number,     tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_payload_length32,   tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_transferred_data,   tvb, local_offset, 220, FALSE);
            break;
        case RMPP_ACK:
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_segment_number,     tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_new_window_last,    tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved220,        tvb, local_offset, 220, FALSE);
            break;
        case RMPP_STOP:
        case RMPP_ABORT:
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32,                     tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_reserved32,                     tvb, local_offset, 4, FALSE); local_offset+=4;
            proto_tree_add_item(RMPP_header_tree, hf_infiniband_optional_extended_error_data,   tvb, local_offset, 220, FALSE);
            break;
        default:
            break;
    }
    *offset = local_offset;
    return TRUE;
}

/* Parse the Method from the MAD Common Header.
* Simply used to generate the identifier.
* IN: SubMItem - the item to append the method label to.
* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
* IN: pinfo - packet info from wireshark. */
static void label_SUBM_Method(proto_item *SubMItem, MAD_Data *MadHeader, packet_info *pinfo)
{
    const char *label = val_to_str(MadHeader->method, SUBM_Methods, "(Unknown SubManagement Method!)");

    proto_item_append_text(SubMItem, "%s", label);
    if (check_col(pinfo->cinfo, COL_INFO))
        col_append_str(pinfo->cinfo, COL_INFO, label);
}

/* Parse the SA Method from the MAD Common Header.
* Simply used to generate the identifier.
* IN: SubAItem - the item to append the method label to.
* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
* IN: pinfo - packet info from wireshark. */
static void label_SUBA_Method(proto_item *SubAItem, MAD_Data *MadHeader, packet_info *pinfo)
{
    const char *label = val_to_str(MadHeader->method, SUBA_Methods, "(Unknown SubAdministration Method!)");

    proto_item_append_text(SubAItem, "%s", label);
    if (check_col(pinfo->cinfo, COL_INFO))
        col_append_str(pinfo->cinfo, COL_INFO, label);
}

/* Parse the Attribute from the MAD Common Header
* Simply used to generate the identifier.
* IN: SubMItem - the item to append the Attribute label to.
* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
* IN: pinfo - packet info from wireshark. */
static void label_SUBM_Attribute(proto_item *SubMItem, MAD_Data *MadHeader, packet_info *pinfo)
{
    const char *label = val_to_str(MadHeader->attributeID, SUBM_Attributes, "(Unknown SubManagement Attribute!)");

    proto_item_append_text(SubMItem, "%s", &label[11]);
    if (check_col(pinfo->cinfo, COL_INFO))
        col_append_str(pinfo->cinfo, COL_INFO, &label[11]);
}

/* Parse the SA Attribute from the MAD Common Header
* Simply used to generate the identifier.
* IN: SubAItem - the item to append the Attribute label to.
* IN: MadHeader - the MadData structure that contains the information from the Common MAD header.
* IN: pinfo - packet info from wireshark. */
static void label_SUBA_Attribute(proto_item *SubAItem, MAD_Data *MadHeader, packet_info *pinfo)
{
    const char *label = val_to_str(MadHeader->attributeID, SUBA_Attributes, "(Unknown SubAdministration Attribute!)");

    proto_item_append_text(SubAItem, "%s", &label[11]);
    if (check_col(pinfo->cinfo, COL_INFO))
        col_append_str(pinfo->cinfo, COL_INFO, &label[11]);
}

/* Parse the attribute from a Subnet Management Packet.
* IN: Parent Tree to add the item to in the dissection tree
* IN: tvbuff, offset - the data and where it is.
* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
static gboolean parse_SUBM_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
{
    guint16 attributeID = MadHeader->attributeID;
    proto_tree *SUBM_Attribute_header_tree = NULL;
    proto_item *SUBM_Attribute_header_item = NULL;

    SUBM_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, *offset, 64, FALSE);
    proto_item_set_text(SUBM_Attribute_header_item, "%s", val_to_str(attributeID, SUBM_Attributes, "Unknown Attribute Type! (0x%02x)"));
    SUBM_Attribute_header_tree = proto_item_add_subtree(SUBM_Attribute_header_item, ett_subm_attribute);


    switch(attributeID)
    {
        case 0x0002:
            parse_NoticesAndTraps(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0010:
             parse_NodeDescription(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0011:
            parse_NodeInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0012:
            parse_SwitchInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0014:
            parse_GUIDInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0015:
            parse_PortInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0016:
            parse_P_KeyTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0017:
            parse_SLtoVLMappingTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0018:
            parse_VLArbitrationTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0019:
            parse_LinearForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x001A:
            parse_RandomForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x001B:
            parse_MulticastForwardingTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x001C:
            parse_SMInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0020:
            parse_VendorDiag(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0030:
            parse_LedInfo(SUBM_Attribute_header_tree , tvb, offset);
            break;
        case 0x0031:
            parse_LinkSpeedWidthPairsTable(SUBM_Attribute_header_tree , tvb, offset);
            break;
        default:
            break;
    }


    *offset += 64;
    return TRUE;

}
/* Parse the attribute from a Subnet Administration Packet.
* IN: Parent Tree to add the item to in the dissection tree
* IN: tvbuff, offset - the data and where it is.
* IN: MAD_Data the data from the Common MAD Header that provides the information we need */
static gboolean parse_SUBA_Attribute(proto_tree *parentTree, tvbuff_t *tvb, gint *offset, MAD_Data *MadHeader)
{
    guint16 attributeID = MadHeader->attributeID;
    proto_tree *SUBA_Attribute_header_tree = NULL;
    proto_item *SUBA_Attribute_header_item = NULL;

    SUBA_Attribute_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, *offset, 200, FALSE);
    proto_item_set_text(SUBA_Attribute_header_item, "%s", val_to_str(attributeID, SUBA_Attributes, "Unknown Attribute Type! (0x%02x)"));
    SUBA_Attribute_header_tree = proto_item_add_subtree(SUBA_Attribute_header_item, ett_suba_attribute);

    /* Skim off the RID fields should they be present */
    parse_RID(SUBA_Attribute_header_tree, tvb, offset, MadHeader);

    /* Parse the rest of the attributes */
    switch(MadHeader->attributeID)
    {
        case 0x0001: /* (ClassPortInfo) */
            parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0002: /* (Notice) */
            parse_NoticesAndTraps(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0003: /* (InformInfo) */
            parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0011: /* (NodeRecord) */
            parse_NodeInfo(SUBA_Attribute_header_tree, tvb, offset);
            *offset += 40;
            parse_NodeDescription(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0012: /* (PortInfoRecord) */
            parse_PortInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0013: /* (SLtoVLMappingTableRecord) */
            parse_SLtoVLMappingTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0014: /* (SwitchInfoRecord) */
            parse_SwitchInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0015: /*(LinearForwardingTableRecord) */
            parse_LinearForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0016: /* (RandomForwardingTableRecord) */
            parse_RandomForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0017: /* (MulticastForwardingTableRecord) */
            parse_MulticastForwardingTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0018: /* (SMInfoRecord) */
            parse_SMInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0019: /* (LinkSpeedWidthPairsTableRecord) */
            parse_LinkSpeedWidthPairsTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x00F3: /*(InformInfoRecord) */
            parse_InformInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0020: /* (LinkRecord) */
            parse_LinkRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0030: /* (GuidInforecord) */
            parse_GUIDInfo(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0031: /*(ServiceRecord) */
            parse_ServiceRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0033: /* (P_KeyTableRecord) */
            parse_P_KeyTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0035: /* (PathRecord) */
            parse_PathRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0036: /* (VLArbitrationTableRecord) */
            parse_VLArbitrationTable(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0038: /* (MCMemberRecord) */
            parse_MCMemberRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x0039: /* (TraceRecord) */
            parse_TraceRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x003A: /* (MultiPathRecord) */
            parse_MultiPathRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        case 0x003B: /* (ServiceAssociationRecord) */
            parse_ServiceAssociationRecord(SUBA_Attribute_header_tree, tvb, offset);
            break;
        default: /* (Unknown SubAdministration Attribute!) */
            /* We've already labeled as unknown in item construction */
            break;
    }

    *offset += 200;
    return TRUE;
}

/* Subnet Management Attribute Parsing Methods.
*  Also Parsing for Attributes common to both SM/SA.
* The Subnet Admin Parsing methods will call some of these methods when an attribute is present within an SA MAD
*/


/* Parse NoticeDataDetails Attribute Field
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       trapNumber - The Trap ID of the Trap Data being Dissected  */

static void parse_NoticeDataDetails(proto_tree* parentTree, tvbuff_t* tvb, gint *offset, guint16 trapNumber)
{
    gint local_offset = *offset;
    proto_tree *DataDetails_header_tree = NULL;
    proto_item *DataDetails_header_item = NULL;

    if(!parentTree)
        return;

    DataDetails_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 54, FALSE);
    DataDetails_header_tree = proto_item_add_subtree(DataDetails_header_item, ett_datadetails);


    switch(trapNumber)
    {
        case 64:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 64 DataDetails");
            local_offset +=6;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR,    tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 65:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 65 DataDetails");
            local_offset +=6;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR,    tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 66:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 66 DataDetails");
            local_offset +=6;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR,    tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 67:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 67 DataDetails");
            local_offset +=6;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR,    tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 68:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 68 DataDetails");
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK,          tvb, local_offset, 8, FALSE);  local_offset+=8;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH,    tvb, local_offset, 1, FALSE);
        break;
        case 69:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 69 DataDetails");
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_COMP_MASK,          tvb, local_offset, 8, FALSE);  local_offset+=8;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_WAIT_FOR_REPATH,    tvb, local_offset, 1, FALSE);
        break;
        case 128:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 128 DataDetails");
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
        break;
        case 129:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 129 DataDetails");
            local_offset += 2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO,         tvb, local_offset, 1, FALSE);  local_offset+=1;
        break;
        case 130:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 130 DataDetails");
            local_offset += 2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO,         tvb, local_offset, 1, FALSE);  local_offset+=1;
        break;
        case 131:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 131 DataDetails");
            local_offset += 2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO,         tvb, local_offset, 1, FALSE);  local_offset+=1;
        break;
        case 144:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 144 DataDetails");
            local_offset +=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_OtherLocalChanges,      tvb, local_offset, 1, FALSE);  local_offset+=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_CAPABILITYMASK,     tvb, local_offset, 4, FALSE);  local_offset+=4;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkSpeecEnabledChange,     tvb, local_offset, 1, FALSE);
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LinkWidthEnabledChange,     tvb, local_offset, 1, FALSE);
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_NodeDescriptionChange,      tvb, local_offset, 1, FALSE);
        break;
        case 145:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 145 DataDetails");
            local_offset +=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            local_offset +=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SYSTEMIMAGEGUID,        tvb, local_offset, 8, FALSE);  local_offset+=8;
        break;
        case 256:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 256 DataDetails");
            local_offset +=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR,            tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRSLID,             tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_METHOD,             tvb, local_offset, 1, FALSE);  local_offset+=1;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEID,        tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_ATTRIBUTEMODIFIER,  tvb, local_offset, 4, FALSE);  local_offset+=4;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_MKEY,               tvb, local_offset, 8, FALSE);  local_offset+=8;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNotice,           tvb, local_offset, 1, FALSE);
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRPathTruncated,    tvb, local_offset, 1, FALSE);
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRHopCount,         tvb, local_offset, 1, FALSE);  local_offset+=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DRNoticeReturnPath, tvb, local_offset, 30, FALSE);  local_offset+=30;
        break;
        case 257:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 257 DataDetails");
            local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY,        tvb, local_offset, 4, FALSE);  local_offset+=4;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL,         tvb, local_offset, 1, FALSE);  local_offset+=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1,   tvb, local_offset, 16, FALSE);  local_offset+=16;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2,   tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 258:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 258 DataDetails");
            local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_KEY,        tvb, local_offset, 4, FALSE);  local_offset+=4;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL,         tvb, local_offset, 1, FALSE);  local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1,   tvb, local_offset, 16, FALSE);  local_offset+=16;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2,   tvb, local_offset, 16, FALSE);  local_offset+=16;
        break;
        case 259:
            proto_item_set_text(DataDetails_header_item, "%s", "Trap 259 DataDetails");
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_DataValid,  tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR1,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_LIDADDR2,   tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PKEY,       tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SL,         tvb, local_offset, 1, FALSE);  local_offset+=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP1,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            local_offset +=1;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_QP2,        tvb, local_offset, 3, FALSE);  local_offset+=3;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR1,   tvb, local_offset, 16, FALSE);  local_offset+=16;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_GIDADDR2,   tvb, local_offset, 16, FALSE);  local_offset+=16;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_SWLIDADDR,  tvb, local_offset, 2, FALSE);  local_offset+=2;
            proto_tree_add_item(DataDetails_header_tree, hf_infiniband_Trap_PORTNO,     tvb, local_offset, 1, FALSE);  local_offset+=1;
        break;
        default:
            proto_item_set_text(DataDetails_header_item, "%s", "Vendor Specific Subnet Management Trap"); local_offset +=54;
            break;
    }

}

/* Parse NoticesAndTraps Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_NoticesAndTraps(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *NoticesAndTraps_header_tree = NULL;
    proto_item *NoticesAndTraps_header_item = NULL;
    guint16 trapNumber = tvb_get_ntohs(tvb, local_offset + 4);

    if(!parentTree)
        return;

    NoticesAndTraps_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(NoticesAndTraps_header_item, "%s", val_to_str(trapNumber, Trap_Description, "Unknown or Vendor Specific Trap Number! (0x%02x)"));
    NoticesAndTraps_header_tree = proto_item_add_subtree(NoticesAndTraps_header_item, ett_noticestraps);

    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IsGeneric,                tvb, local_offset, 1, FALSE);
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_Type,                     tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ProducerTypeVendorID,     tvb, local_offset, 3, FALSE); local_offset+=3;
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_TrapNumberDeviceID,       tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerLID,                tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeToggle,             tvb, local_offset, 1, FALSE);
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_NoticeCount,              tvb, local_offset, 2, FALSE); local_offset+=2;

    parse_NoticeDataDetails(NoticesAndTraps_header_tree, tvb, &local_offset, trapNumber);
    proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_DataDetails,              tvb, local_offset, 54, FALSE); local_offset+=54;

    /* Only Defined For GMPs not SMPs which is not part of this dissector phase
    *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_IssuerGID,               tvb, local_offset, 16, FALSE); local_offset+=16;
    *proto_tree_add_item(NoticesAndTraps_header_tree, hf_infiniband_Notice_ClassTrapSpecificData,   tvb, local_offset, 1, FALSE); local_offset+=1; */

}

/* Parse NodeDescription Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_NodeDescription(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *NodeDescription_header_tree = NULL;

    if(!parentTree)
        return;

    NodeDescription_header_tree = parentTree;
    proto_tree_add_item(NodeDescription_header_tree, hf_infiniband_NodeDescription_NodeString,  tvb, local_offset, 64, FALSE);
}

/* Parse NodeInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_NodeInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *NodeInfo_header_tree = NULL;

    if(!parentTree)
        return;

    NodeInfo_header_tree = parentTree;

    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_BaseVersion,       tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_ClassVersion,      tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeType,          tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NumPorts,          tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_SystemImageGUID,   tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_NodeGUID,          tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PortGUID,          tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_PartitionCap,      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_DeviceID,          tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_Revision,          tvb, local_offset, 4, FALSE); local_offset +=4;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_LocalPortNum,      tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(NodeInfo_header_tree, hf_infiniband_NodeInfo_VendorID,          tvb, local_offset, 3, FALSE); local_offset +=3;

}

/* Parse SwitchInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_SwitchInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *SwitchInfo_header_tree = NULL;

    if(!parentTree)
        return;

    SwitchInfo_header_tree = parentTree;

    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBCap,                      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_RandomFDBCap,                      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_MulticastFDBCap,                   tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LinearFDBTop,                      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultPort,                       tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort,       tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort,    tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LifeTimeValue,                     tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PortStateChange,                   tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_LIDsPerPort,                       tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_PartitionEnforcementCap,           tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_InboundEnforcementCap,             tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_OutboundEnforcementCap,            tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawInboundCap,               tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_FilterRawOutboundCap,              tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SwitchInfo_header_tree, hf_infiniband_SwitchInfo_EnhancedPortZero,                  tvb, local_offset, 1, FALSE); local_offset +=1;
}

/* Parse GUIDInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_GUIDInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *GUIDInfo_header_tree = NULL;
    proto_item *tempItemLow = NULL;
    gint i = 0;

    if(!parentTree)
        return;

    GUIDInfo_header_tree = parentTree;

    for(i = 0; i < 8; i++)
    {
        proto_tree_add_item(GUIDInfo_header_tree, hf_infiniband_GUIDInfo_GUID, tvb, local_offset, 8, FALSE); local_offset +=8;
        proto_item_append_text(tempItemLow, "(%u)", i);
    }

}

/* Parse PortInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_PortInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *PortInfo_header_tree = NULL;
    proto_tree *PortInfo_CapabilityMask_tree = NULL;
    proto_item *PortInfo_CapabilityMask_item = NULL;
    proto_item *temp_item = NULL;
    guint16 temp_val = 0;

    if(!parentTree)
        return;

    PortInfo_header_tree = parentTree;

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_Key,                 tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GidPrefix,             tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LID,                   tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMLID,           tvb, local_offset, 2, FALSE); local_offset +=2;

    /* Capability Mask Flags */
    PortInfo_CapabilityMask_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_CapabilityMask,     tvb, local_offset, 4, FALSE);
    PortInfo_CapabilityMask_tree = proto_item_add_subtree(PortInfo_CapabilityMask_item, ett_portinfo_capmask);

    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SM,                             tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_NoticeSupported,                tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_TrapSupported,                  tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported,            tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported,    tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported,             tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM,                      tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM,                      tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported,               tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SMdisabled,                     tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported,       tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported,    tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported,      tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported,                 tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ReinitSupported,                tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported,      tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported,           tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported,              tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported,  tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported,        tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported,  tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported,    tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported,   tvb, local_offset, 4, FALSE);
    proto_tree_add_item(PortInfo_CapabilityMask_tree, hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported,  tvb, local_offset, 4, FALSE);
    local_offset+=4;
    /* End Capability Mask Flags */

    /* Diag Code */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_DiagCode,              tvb, local_offset, 2, FALSE);
    temp_val = tvb_get_ntohs(tvb, local_offset);

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, DiagCode, "Reserved DiagCode! Possible Error"));
    local_offset +=2;
    /* End Diag Code */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyLeasePeriod,      tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPortNum,          tvb, local_offset, 1, FALSE); local_offset +=1;

    /* LinkWidthEnabled */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthEnabled,      tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthEnabled, "Reserved LinkWidthEnabled Value! Possible Error"));
    local_offset +=1;
    /* End LinkWidthEnabled */

    /* LinkWidthSupported */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthSupported,    tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthSupported, "Reserved LinkWidthSupported Value! Possible Error"));
    local_offset +=1;
    /* End LinkWidthSupported */

    /* LinkWidthActive */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkWidthActive,       tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkWidthActive, "Reserved LinkWidthActive Value! Possible Error"));
    local_offset +=1;
    /* End LinkWidthActive */

    /* LinkSpeedSupported */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedSupported,    tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedSupported, "Reserved LinkWidthSupported Value! Possible Error"));
    /* End LinkSpeedSupported */

    /* PortState */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortState,             tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x000F;
    /*temp_val = temp_val >> 4 */

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortState, "Reserved PortState Value! Possible Error"));
    local_offset +=1;
    /* End PortState */

    /* PortPhysicalState */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PortPhysicalState,     tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, PortPhysicalState, "Reserved PortPhysicalState Value! Possible Error"));
    /* End PortPhysicalState */

    /* LinkDownDefaultState */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkDownDefaultState,  tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x000F;
    /*temp_val = temp_val >> 4 */

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkDownDefaultState, "Reserved LinkDownDefaultState Value! Possible Error"));
    local_offset +=1;
    /* End LinkDownDefaultState */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyProtectBits,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LMC,                   tvb, local_offset, 1, FALSE); local_offset +=1;

    /* LinkSpeedActive */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedActive,       tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedActive, "Reserved LinkSpeedActive Value! Possible Error"));
    /* End LinkSpeedActive */

    /* LinkSpeedEnabled */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkSpeedEnabled,      tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x000F;
    /*temp_val = temp_val >> 4 */

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, LinkSpeedEnabled, "Reserved LinkSpeedEnabled Value! Possible Error"));
    local_offset +=1;
    /* End LinkSpeedEnabled */

    /* NeighborMTU */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_NeighborMTU,           tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, NeighborMTU, "Reserved NeighborMTU Value! Possible Error"));

    /* End NeighborMTU */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MasterSMSL,            tvb, local_offset, 1, FALSE); local_offset +=1;

    /* VLCap */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLCap,                 tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, VLCap, "Reserved VLCap Value! Possible Error"));

    /* End VLCap */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitType,              tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLHighLimit,           tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationHighCap,  tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLArbitrationLowCap,   tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_InitTypeReply,         tvb, local_offset, 1, FALSE);

    /* MTUCap */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MTUCap,                tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x000F;
    /*temp_val = temp_val >> 4 */

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, MTUCap, "Reserved MTUCap Value! Possible Error"));
    local_offset +=1;
    /* End MTUCap */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_VLStallCount,          tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_HOQLife,               tvb, local_offset, 1, FALSE); local_offset +=1;

    /* OperationalVLs */
    temp_item = proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OperationalVLs,        tvb, local_offset, 1, FALSE);
    temp_val = (guint16)tvb_get_guint8(tvb, local_offset);

    /* 4 bit values = mask and shift */
    temp_val = temp_val & 0x00F0;
    temp_val = temp_val >> 4;

    proto_item_append_text(temp_item, ", %s", val_to_str(temp_val, OperationalVLs, "Reserved OperationalVLs Value! Possible Error"));
    /* End OperationalVLs */

    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementInbound,       tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_PartitionEnforcementOutbound,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawInbound,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_FilterRawOutbound,     tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_M_KeyViolations,       tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_P_KeyViolations,       tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_Q_KeyViolations,       tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_GUIDCap,               tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_ClientReregister,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_SubnetTimeOut,         tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_RespTimeValue,         tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LocalPhyErrors,        tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_OverrunErrors,         tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_MaxCreditHint,         tvb, local_offset, 2, FALSE); local_offset +=3; /* 2 + 1 Reserved */
    proto_tree_add_item(PortInfo_header_tree, hf_infiniband_PortInfo_LinkRoundTripLatency,  tvb, local_offset, 3, FALSE); local_offset +=3;
}

/* Parse P_KeyTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_P_KeyTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    gint i = 0;
    proto_tree *P_KeyTable_header_tree = NULL;
    proto_item *P_KeyTable_header_item = NULL;
    proto_item *tempItemLow = NULL;
    proto_item *tempItemHigh = NULL;

    if(!parentTree)
        return;

    P_KeyTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_P_KeyTable_P_KeyTableBlock, tvb, local_offset, 64, FALSE);
    proto_item_set_text(P_KeyTable_header_item, "%s", "P_KeyTable");
    P_KeyTable_header_tree = proto_item_add_subtree(P_KeyTable_header_item, ett_pkeytable);

    for(i = 0; i < 32; i++)
    {
        tempItemLow = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_MembershipType,  tvb, local_offset, 1, FALSE);
        tempItemHigh = proto_tree_add_item(P_KeyTable_header_tree, hf_infiniband_P_KeyTable_P_KeyBase,          tvb, local_offset, 2, FALSE); local_offset +=2;
        proto_item_append_text(tempItemLow, "(%u)", i);
        proto_item_append_text(tempItemHigh,"(%u)", i+1);
    }
}

/* Parse SLtoVLMappingTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_SLtoVLMappingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *SLtoVLMappingTable_header_tree = NULL;
    proto_item *SLtoVLMappingTable_header_item = NULL;
    proto_item *tempItemLow = NULL;
    proto_item *tempItemHigh = NULL;
    gint i = 0;

    if(!parentTree)
        return;

    SLtoVLMappingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(SLtoVLMappingTable_header_item, "%s", "SLtoVLMappingTable");
    SLtoVLMappingTable_header_tree = proto_item_add_subtree(SLtoVLMappingTable_header_item, ett_sltovlmapping);

    for(i = 0; i < 8; i++)
    {
        tempItemLow = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits,  tvb, local_offset, 1, FALSE);
        tempItemHigh = proto_tree_add_item(SLtoVLMappingTable_header_tree, hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits,  tvb, local_offset, 1, FALSE); local_offset +=1;
        proto_item_append_text(tempItemLow, "(%u)", i);
        proto_item_append_text(tempItemHigh,"(%u)", i+1);
    }
}

/* Parse VLArbitrationTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_VLArbitrationTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    gint i = 0;
    proto_tree *VLArbitrationTable_header_tree = NULL;
    proto_item *VLArbitrationTable_header_item = NULL;
    proto_item *tempItemLow = NULL;
    proto_item *tempItemHigh = NULL;

    if(!parentTree)
        return;

    VLArbitrationTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(VLArbitrationTable_header_item, "%s", "VLArbitrationTable");
    VLArbitrationTable_header_tree = proto_item_add_subtree(VLArbitrationTable_header_item, ett_vlarbitrationtable);

    for(i = 0; i < 32; i++)
    {
        tempItemLow = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_VL,      tvb, local_offset, 1, FALSE); local_offset +=1;
        tempItemHigh = proto_tree_add_item(VLArbitrationTable_header_tree, hf_infiniband_VLArbitrationTable_Weight, tvb, local_offset, 1, FALSE); local_offset +=1;
        proto_item_append_text(tempItemLow, "(%u)", i);
        proto_item_append_text(tempItemHigh,"(%u)", i);
    }
}

/* Parse LinearForwardingTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_LinearForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint i = 0;
    gint local_offset = *offset;
    proto_tree *LinearForwardingTable_header_tree = NULL;
    proto_item *LinearForwardingTable_header_item = NULL;
    proto_item *tempItemLow = NULL;

    if(!parentTree)
        return;

    LinearForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(LinearForwardingTable_header_item, "%s", "LinearForwardingTable");
    LinearForwardingTable_header_tree = proto_item_add_subtree(LinearForwardingTable_header_item, ett_linearforwardingtable);

    for(i = 0; i < 64; i++)
    {
        tempItemLow = proto_tree_add_item(LinearForwardingTable_header_tree, hf_infiniband_LinearForwardingTable_Port, tvb, local_offset, 1, FALSE); local_offset +=1;
        proto_item_append_text(tempItemLow, "(%u)", i);
    }
}

/* Parse RandomForwardingTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_RandomForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint i = 0;
    gint local_offset = *offset;
    proto_tree *RandomForwardingTable_header_tree = NULL;
    proto_item *RandomForwardingTable_header_item = NULL;
    proto_item *tempItemLow = NULL;

    if(!parentTree)
        return;

    RandomForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(RandomForwardingTable_header_item, "%s", "RandomForwardingTable");
    RandomForwardingTable_header_tree = proto_item_add_subtree(RandomForwardingTable_header_item, ett_randomforwardingtable);

    for(i = 0; i < 16; i++)
    {
        tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LID,   tvb, local_offset, 2, FALSE); local_offset +=2;
        proto_item_append_text(tempItemLow, "(%u)", i);
        tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Valid, tvb, local_offset, 1, FALSE);
        proto_item_append_text(tempItemLow, "(%u)", i);
        tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_LMC,   tvb, local_offset, 1, FALSE); local_offset +=1;
        proto_item_append_text(tempItemLow, "(%u)", i);
        tempItemLow = proto_tree_add_item(RandomForwardingTable_header_tree, hf_infiniband_RandomForwardingTable_Port,  tvb, local_offset, 1, FALSE); local_offset +=1;
        proto_item_append_text(tempItemLow, "(%u)", i);
    }
}

/* Parse NoticesAndTraps Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_MulticastForwardingTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint i = 0;
    gint local_offset = *offset;
    proto_tree *MulticastForwardingTable_header_tree = NULL;
    proto_item *MulticastForwardingTable_header_item = NULL;
    proto_item *tempItemLow = NULL;

    if(!parentTree)
        return;

    MulticastForwardingTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(MulticastForwardingTable_header_item, "%s", "MulticastForwardingTable");
    MulticastForwardingTable_header_tree = proto_item_add_subtree(MulticastForwardingTable_header_item, ett_multicastforwardingtable);

    for(i = 0; i < 16; i++)
    {
        tempItemLow = proto_tree_add_item(MulticastForwardingTable_header_tree, hf_infiniband_MulticastForwardingTable_PortMask, tvb, local_offset, 2, FALSE); local_offset +=2;
        proto_item_append_text(tempItemLow, "(%u)", i);
    }

}

/* Parse SMInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_SMInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *SMInfo_header_tree = NULL;
    proto_item *SMInfo_header_item = NULL;

    if(!parentTree)
        return;

    SMInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(SMInfo_header_item, "%s", "SMInfo");
    SMInfo_header_tree = proto_item_add_subtree(SMInfo_header_item, ett_sminfo);

    proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_GUID,      tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SM_Key,    tvb, local_offset, 8, FALSE); local_offset +=8;
    proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_ActCount,  tvb, local_offset, 4, FALSE); local_offset +=4;
    proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_Priority,  tvb, local_offset, 1, FALSE);
    proto_tree_add_item(SMInfo_header_tree, hf_infiniband_SMInfo_SMState,   tvb, local_offset, 1, FALSE); local_offset +=1;
}

/* Parse VendorDiag Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_VendorDiag(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *VendorDiag_header_tree = NULL;
    proto_item *VendorDiag_header_item = NULL;

    if(!parentTree)
        return;

    VendorDiag_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(VendorDiag_header_item, "%s", "VendorDiag");
    VendorDiag_header_tree = proto_item_add_subtree(VendorDiag_header_item, ett_vendordiag);

    proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_NextIndex,     tvb, local_offset, 2, FALSE); local_offset +=2;
    proto_tree_add_item(VendorDiag_header_tree, hf_infiniband_VendorDiag_DiagData,      tvb, local_offset, 62, FALSE); local_offset +=62;
}

/* Parse LedInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_LedInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *LedInfo_header_tree = NULL;
    proto_item *LedInfo_header_item = NULL;

    if(!parentTree)
        return;

    LedInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(LedInfo_header_item, "%s", "LedInfo");
    LedInfo_header_tree = proto_item_add_subtree(LedInfo_header_item, ett_ledinfo);

    proto_tree_add_item(LedInfo_header_tree, hf_infiniband_LedInfo_LedMask,     tvb, local_offset, 1, FALSE);
}

/* Parse LinkSpeedWidthPairsTable Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_LinkSpeedWidthPairsTable(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *LinkSpeedWidthPairsTable_header_tree = NULL;
    proto_item *LinkSpeedWidthPairsTable_header_item = NULL;

    if(!parentTree)
        return;

    LinkSpeedWidthPairsTable_header_item = proto_tree_add_item(parentTree, hf_infiniband_smp_data, tvb, local_offset, 64, FALSE);
    proto_item_set_text(LinkSpeedWidthPairsTable_header_item, "%s", "LinkSpeedWidthPairsTable");
    LinkSpeedWidthPairsTable_header_tree = proto_item_add_subtree(LinkSpeedWidthPairsTable_header_item, ett_linkspeedwidthpairs);

    proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_NumTables,     tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_PortMask,      tvb, local_offset, 32, FALSE); local_offset +=32;
    proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive,  tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive,     tvb, local_offset, 1, FALSE); local_offset +=1;
    proto_tree_add_item(LinkSpeedWidthPairsTable_header_tree, hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen,      tvb, local_offset, 1, FALSE); local_offset +=1;
}

/* Parse RID Field from Subnet Administraiton Packets.
* IN: SA_header_tree - the dissection tree of the subnet admin attribute.
*     tvb - the packet buffer
*      MadHeader - the Common MAD header from this packet.
* IN/OUT:  offset - the current and updated offset in the packet buffer */
static void parse_RID(proto_tree* SA_header_tree, tvbuff_t* tvb, gint *offset, MAD_Data* MadHeader)
{
    gint local_offset = *offset;
    if(!SA_header_tree)
    {
        return;
    }
        switch(MadHeader->attributeID)
        {
            case 0x0011:
                /* NodeRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,   tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=2; /* Reserved bits */
                break;
            case 0x0012:
                /* PortInfoRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_EndportLID,    tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum,       tvb, local_offset, 1, FALSE); local_offset+=1;
                local_offset+=1; /* Reserved bits */
                break;
            case 0x0013:
                /* SLtoVLMappingTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,           tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_InputPortNum,  tvb, local_offset, 1, FALSE); local_offset+=1;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
                local_offset+=4; /* Reserved bits */
                break;
            case 0x0014:
                /* SwitchInfoRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,           tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=2; /* Reserved bits */
                break;
            case 0x0015:
                /* LinearForwardingTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,                   tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit,   tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=4; /* Reserved bits */
                break;
            case 0x0016:
                /* RandomForwardingTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,                   tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit,   tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=4; /* Reserved bits */
                break;
            case 0x0017:
                /* MulticastForwardingTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,               tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_Position,          tvb, local_offset, 1, FALSE);
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_NineBit,  tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=4; /* Reserved bits */
                break;
            case 0x0036:
                /*VLArbitrationTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,           tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_OutputPortNum, tvb, local_offset, 1, FALSE); local_offset+=1;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit,     tvb, local_offset, 1, FALSE); local_offset+=1;
                local_offset+=4; /* Reserved bits */
                break;
            case 0x0018:
                /* SMInfoRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,               tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=2; /* Reserved bits */
                break;
            case 0x0033:
                /* P_KeyTableRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,                   tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_SixteenBit,   tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_PortNum,               tvb, local_offset, 1, FALSE); local_offset+=1;
                local_offset+=3; /* Reserved bits */
                break;
            case 0x00F3:
                /* InformInfoRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_SubscriberGID,   tvb, local_offset, 16, FALSE); local_offset+=16;
                proto_tree_add_item(SA_header_tree, hf_infiniband_InformInfoRecord_Enum,            tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=6; /* Reserved bits */
                break;
            case 0x0020:
                /* LinkRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromLID,   tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_LinkRecord_FromPort,  tvb, local_offset, 1, FALSE); local_offset+=1;
                break;
            case 0x0031:
                /* ServiceRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceID,      tvb, local_offset, 8, FALSE); local_offset+=8;
                proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceGID,     tvb, local_offset, 16, FALSE); local_offset+=16;
                proto_tree_add_item(SA_header_tree, hf_infiniband_ServiceRecord_ServiceP_Key,   tvb, local_offset, 2, FALSE); local_offset+=2;
                local_offset+=2;
                break;
            case 0x0038:
                /* MCMemberRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_MGID,      tvb, local_offset, 16, FALSE); local_offset+=16;
                proto_tree_add_item(SA_header_tree, hf_infiniband_MCMemberRecord_PortGID,   tvb, local_offset, 16, FALSE); local_offset+=16;
                break;
            case 0x0030:
                /* GuidInfoRecord */
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_LID,               tvb, local_offset, 2, FALSE); local_offset+=2;
                proto_tree_add_item(SA_header_tree, hf_infiniband_SA_BlockNum_EightBit, tvb, local_offset, 1, FALSE); local_offset+=2;
                local_offset+=4;
                break;
            default:
                break;
        }

    *offset = local_offset;
}

/* Parse InformInfo Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_InformInfo(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *InformInfo_header_tree = NULL;
    proto_item *InformInfo_header_item = NULL;
    if(!parentTree)
    {
        return;
    }
    InformInfo_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 36, FALSE);
    proto_item_set_text(InformInfo_header_item, "%s", "InformInfo");
    InformInfo_header_tree = proto_item_add_subtree(InformInfo_header_item, ett_informinfo);

    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_GID,                   tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeBegin,         tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_LIDRangeEnd,           tvb, local_offset, 2, FALSE); local_offset+=2;
    local_offset+=2; /* Reserved Bits */
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_IsGeneric,             tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Subscribe,             tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_Type,                  tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_TrapNumberDeviceID,    tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_QPN,                   tvb, local_offset, 3, FALSE); local_offset+=3;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_RespTimeValue,         tvb, local_offset, 1, FALSE); local_offset+=1;
    local_offset+=1;
    proto_tree_add_item(InformInfo_header_tree, hf_infiniband_InformInfo_ProducerTypeVendorID,  tvb, local_offset, 3, FALSE); local_offset+=3;

}
/* Parse LinkRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_LinkRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *LinkRecord_header_tree = NULL;
    proto_item *LinkRecord_header_item = NULL;

    if(!parentTree)
    {
        return;
    }

    LinkRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 3, FALSE);
    proto_item_set_text(LinkRecord_header_item, "%s", "LinkRecord");
    LinkRecord_header_tree = proto_item_add_subtree(LinkRecord_header_item, ett_linkrecord);

    proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToPort,    tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(LinkRecord_header_tree, hf_infiniband_LinkRecord_ToLID,     tvb, local_offset, 2, FALSE); local_offset +=2;

}
/* Parse ServiceRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_ServiceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *ServiceRecord_header_tree = NULL;
    proto_item *ServiceRecord_header_item = NULL;
    proto_item *tempData = NULL;

    if(!parentTree)
    {
        return;
    }

    ServiceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 176, FALSE);
    proto_item_set_text(ServiceRecord_header_item, "%s", "ServiceRecord");
    ServiceRecord_header_tree = proto_item_add_subtree(ServiceRecord_header_item, ett_servicerecord);

    proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceLease,    tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceKey,      tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceName,     tvb, local_offset, 64, FALSE); local_offset+=64;

    tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData,      tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_item_append_text(tempData, "%s", "(ServiceData 8.1, 8.16)");
    tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData,      tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_item_append_text(tempData, "%s", "(ServiceData 16.1, 16.8)");
    tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData,      tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_item_append_text(tempData, "%s", "(ServiceData 32.1, 32.4)");
    tempData = proto_tree_add_item(ServiceRecord_header_tree, hf_infiniband_ServiceRecord_ServiceData,      tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_item_append_text(tempData, "%s", "(ServiceData 64.1, 64.2)");

}
/* Parse PathRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_PathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *PathRecord_header_tree = NULL;
    proto_item *PathRecord_header_item = NULL;

    if(!parentTree)
    {
        return;
    }

    PathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
    proto_item_set_text(PathRecord_header_item, "%s", "PathRecord");
    PathRecord_header_tree = proto_item_add_subtree(PathRecord_header_item, ett_pathrecord);
    local_offset += 8; /* Reserved Bits */

    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DGID,          tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SGID,          tvb, local_offset, 16, FALSE); local_offset+=16;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_DLID,          tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SLID,          tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RawTraffic,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_FlowLabel,     tvb, local_offset, 3, FALSE); local_offset+=3;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_HopLimit,      tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_TClass,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Reversible,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_NumbPath,      tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_P_Key,         tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_SL,            tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTUSelector,   tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_MTU,           tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_RateSelector,  tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Rate,          tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTimeSelector,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_PacketLifeTime,            tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(PathRecord_header_tree, hf_infiniband_PathRecord_Preference,                tvb, local_offset, 1, FALSE); local_offset+=1;
}
/* Parse MCMemberRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_MCMemberRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *MCMemberRecord_header_tree = NULL;
    proto_item *MCMemberRecord_header_item = NULL;

    if(!parentTree)
    {
        return;
    }

    MCMemberRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 64, FALSE);
    proto_item_set_text(MCMemberRecord_header_item, "%s", "MCMemberRecord");
    MCMemberRecord_header_tree = proto_item_add_subtree(MCMemberRecord_header_item, ett_mcmemberrecord);

    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Q_Key,         tvb, local_offset, 4, FALSE); local_offset+=4;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MLID,          tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTUSelector,   tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_MTU,           tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_TClass,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_P_Key,         tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_RateSelector,  tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Rate,          tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTimeSelector,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_PacketLifeTime,            tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_SL,            tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_FlowLabel,     tvb, local_offset, 3, FALSE); local_offset+=3;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_HopLimit,      tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_Scope,         tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_JoinState,     tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MCMemberRecord_header_tree, hf_infiniband_MCMemberRecord_ProxyJoin,     tvb, local_offset, 1, FALSE); local_offset+=3;

}
/* Parse TraceRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_TraceRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *TraceRecord_header_tree = NULL;
    proto_item *TraceRecord_header_item = NULL;

    if(!parentTree)
    {
        return;
    }

    TraceRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 46, FALSE);
    proto_item_set_text(TraceRecord_header_item, "%s", "TraceRecord");
    TraceRecord_header_tree = proto_item_add_subtree(TraceRecord_header_item, ett_tracerecord);

    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_GIDPrefix,       tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_IDGeneration,    tvb, local_offset, 2, FALSE); local_offset+=2;
    local_offset+=1; /* Reserved Bits */
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeType,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_NodeID,          tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ChassisID,       tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPortID,     tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPortID,      tvb, local_offset, 8, FALSE); local_offset+=8;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_EntryPort,       tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(TraceRecord_header_tree, hf_infiniband_TraceRecord_ExitPort,        tvb, local_offset, 1, FALSE); local_offset+=1;
}
/* Parse MultiPathRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_MultiPathRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *MultiPathRecord_header_tree = NULL;
    proto_item *MultiPathRecord_header_item = NULL;
    proto_item *SDGID = NULL;
    guint8 SDGIDCount = 0;
    guint8 DGIDCount = 0;
    guint32 i = 0;

    if(!parentTree)
    {
        return;
    }

    MultiPathRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 200, FALSE);
    proto_item_set_text(MultiPathRecord_header_item, "%s", "MultiPathRecord");
    MultiPathRecord_header_tree = proto_item_add_subtree(MultiPathRecord_header_item, ett_multipathrecord);

    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RawTraffic,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_FlowLabel,       tvb, local_offset, 3, FALSE); local_offset+=3;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_HopLimit,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_TClass,          tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Reversible,      tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_NumbPath,        tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_P_Key,           tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SL,              tvb, local_offset, 2, FALSE); local_offset+=2;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTUSelector,     tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_MTU,             tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_RateSelector,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_Rate,            tvb, local_offset, 1, FALSE); local_offset+=1;
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTimeSelector,  tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_PacketLifeTime,          tvb, local_offset, 1, FALSE); local_offset+=1;
    local_offset+=1; /* Reserved Bits */
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_IndependenceSelector,    tvb, local_offset, 1, FALSE);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_GIDScope,                tvb, local_offset, 1, FALSE); local_offset+=1;

    SDGIDCount = tvb_get_guint8(tvb, local_offset);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SGIDCount,       tvb, local_offset, 1, FALSE); local_offset+=1;
    DGIDCount = tvb_get_guint8(tvb, local_offset);
    proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_DGIDCount,       tvb, local_offset, 1, FALSE); local_offset+=1;
    local_offset+=7; /*Reserved Bits */

    for(i = 0; i < SDGIDCount; i++)
    {
        SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID,       tvb, local_offset, 16, FALSE); local_offset+=16;
        proto_item_set_text(SDGID, "(%s%u)","SGID", i);
    }
    for(i = 0; i < DGIDCount; i++)
    {
        SDGID = proto_tree_add_item(MultiPathRecord_header_tree, hf_infiniband_MultiPathRecord_SDGID,       tvb, local_offset, 16, FALSE); local_offset+=16;
        proto_item_set_text(SDGID, "(%s%u)","DGID", i);
    }
}
/* Parse ServiceAssociationRecord Attribute
* IN:   parentTree - The tree to add the dissection to
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       MadHeader - The common MAD header of the current SMP/SMA  */
static void parse_ServiceAssociationRecord(proto_tree* parentTree, tvbuff_t* tvb, gint *offset)
{
    gint local_offset = *offset;
    proto_tree *ServiceAssociationRecord_header_tree = NULL;
    proto_item *ServiceAssociationRecord_header_item = NULL;

    if(!parentTree)
    {
        return;
    }

    ServiceAssociationRecord_header_item = proto_tree_add_item(parentTree, hf_infiniband_SA, tvb, local_offset, 80, FALSE);
    proto_item_set_text(ServiceAssociationRecord_header_item, "%s", "ServiceAssociationRecord");
    ServiceAssociationRecord_header_tree = proto_item_add_subtree(ServiceAssociationRecord_header_item, ett_serviceassocrecord);

    proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceKey,        tvb, local_offset, 16, FALSE); local_offset +=16;
    proto_tree_add_item(ServiceAssociationRecord_header_tree, hf_infiniband_ServiceAssociationRecord_ServiceName,       tvb, local_offset, 64, FALSE); local_offset +=64;
}

/* dissect_general_info
* Used to extract very few values from the packet in the case that full dissection is disabled by the user.
* IN:
*       tvb - The tvbbuff of packet data
*       offset - The offset in TVB where the attribute begins
*       pinfo - The packet info structure with column information */
static void dissect_general_info(tvbuff_t *tvb, gint offset, packet_info *pinfo)
{
    guint8 lnh_val = 0;             /* The Link Next Header Value.  Tells us which headers are coming */
    gboolean bthFollows = 0;        /* Tracks if we are parsing a BTH.  This is a significant decision point */
    guint8 virtualLane = 0;         /* The Virtual Lane of the current Packet */
    guint8 opCode = 0;              /* OpCode from BTH header. */
    gint32 nextHeaderSequence = -1; /* defined by this dissector. #define which indicates the upcoming header sequence from OpCode */
    guint8 nxtHdr = 0;              /* that must be available for that header. */
    struct e_in6_addr SRCgid;       /* Struct to display ipv6 Address */
    struct e_in6_addr DSTgid;       /* Struct to display ipv6 Address */
    guint8 management_class = 0;
    MAD_Data MadData;


    virtualLane =  tvb_get_guint8(tvb, offset);
    virtualLane = virtualLane & 0xF0;
    offset+=1;

    /* Save Link Next Header... This tells us what the next header is. */
    lnh_val =  tvb_get_guint8(tvb, offset);
    lnh_val = lnh_val & 0x03;
    offset+=1;

    /* Set destination in packet view. */
    if (check_col(pinfo->cinfo, COL_DEF_DST))
    {
        col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DLID: %s", tvb_bytes_to_str(tvb, offset, 2));
    }
    offset+=4;

    /* Set Source in packet view. */
    if (check_col(pinfo->cinfo, COL_DEF_SRC))
    {
        col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SLID: %s", tvb_bytes_to_str(tvb, offset, 2));
    }
    offset+=2;

    switch(lnh_val)
    {
        case IBA_GLOBAL:
            offset +=6;
            nxtHdr = tvb_get_guint8(tvb, offset);
            offset += 2;

            tvb_get_ipv6(tvb, offset, &SRCgid);
            if (check_col(pinfo->cinfo, COL_DEF_SRC))
            {
                col_add_fstr(pinfo->cinfo, COL_DEF_SRC, "SGID: %s", ip6_to_str(&SRCgid));
            }
            offset += 16;

            tvb_get_ipv6(tvb, offset, &DSTgid);
            if (check_col(pinfo->cinfo, COL_DEF_DST))
            {
                col_add_fstr(pinfo->cinfo, COL_DEF_DST, "DGID: %s", ip6_to_str(&DSTgid));
            }
            offset += 16;

            if(nxtHdr != 0x1B)
            {
                /* Some kind of packet being transported globally with IBA, but locally it is not IBA - no BTH following. */
                break;
            }
            /* else
             * {
             *      Fall through switch and start parsing Local Headers and BTH
             * }
             */
        case IBA_LOCAL:
            bthFollows = TRUE;

            /* Get the OpCode - this tells us what headers are following */
            opCode = tvb_get_guint8(tvb, offset);
            if (check_col(pinfo->cinfo, COL_INFO))
            {
                col_append_str(pinfo->cinfo, COL_INFO, val_to_str((guint32)opCode, OpCodeMap, "Unknown OpCode"));
            }
            offset +=12;
            break;
        case IP_NON_IBA:
            /* Raw IPv6 Packet */
            if (check_col(pinfo->cinfo, COL_DEF_DST))
            {
                col_set_str(pinfo->cinfo, COL_DEF_DST, "IPv6 over IB Packet");
                col_set_fence(pinfo->cinfo, COL_DEF_DST);
            }
            break;
        case RAW:
            break;
        default:
            break;
    }

    if(bthFollows)
    {
        /* Find our next header sequence based on the Opcode
         * Since we're not doing dissection here, we just need the proper offsets to get our labels in packet view */

        nextHeaderSequence = find_next_header_sequence((guint32) opCode);
        switch(nextHeaderSequence)
        {
            case RDETH_DETH_PAYLD:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                break;
            case RDETH_DETH_RETH_PAYLD:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                offset += 16; /* RETH */
                break;
            case RDETH_DETH_IMMDT_PAYLD:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                offset += 4; /* IMMDT */
                break;
            case RDETH_DETH_RETH_IMMDT_PAYLD:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                offset += 16; /* RETH */
                offset += 4; /* IMMDT */
                break;
            case RDETH_DETH_RETH:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                offset += 16; /* RETH */
                break;
            case RDETH_AETH_PAYLD:
                offset += 4; /* RDETH */
                offset += 4; /* AETH */
                break;
            case RDETH_PAYLD:
                offset += 4; /* RDETH */
                break;
            case RDETH_AETH:
                offset += 4; /* RDETH */
                offset += 4; /* AETH */
                break;
            case RDETH_AETH_ATOMICACKETH:
                offset += 4; /* RDETH */
                offset += 4; /* AETH */
                offset += 8; /* AtomicAckETH */
                break;
            case RDETH_DETH_ATOMICETH:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                offset += 28; /* AtomicETH */
                break;
            case RDETH_DETH:
                offset += 4; /* RDETH */
                offset += 8; /* DETH */
                break;
            case DETH_PAYLD:
                offset += 8; /* DETH */
                break;
            case PAYLD:
                break;
            case IMMDT_PAYLD:
                offset += 4; /* IMMDT */
                break;
            case RETH_PAYLD:
                offset += 16; /* RETH */
                break;
            case RETH:
                offset += 16; /* RETH */
                break;
            case AETH_PAYLD:
                offset += 4; /* AETH */
                break;
            case AETH:
                offset += 4; /* AETH */
                break;
            case AETH_ATOMICACKETH:
                offset += 4; /* AETH */
                offset += 8; /* AtomicAckETH */
                break;
            case ATOMICETH:
                offset += 28; /* AtomicETH */
                break;
            case IETH_PAYLD:
                offset += 4; /* IETH */
                break;
            case DETH_IMMDT_PAYLD:
                offset += 8; /* DETH */
                offset += 4; /* IMMDT */
                break;
            default:
                break;
        }
    }
    if(virtualLane == 0xF0)
    {
        management_class =  tvb_get_guint8(tvb, offset + 1);
        if(((management_class >= (guint8)VENDOR_1_START) && (management_class <= (guint8)VENDOR_1_END))
        || ((management_class >= (guint8)VENDOR_2_START) && (management_class <= (guint8)VENDOR_2_END)))
        {
            return;
        }
        else if((management_class >= (guint8)APPLICATION_START) && (management_class <= (guint8)APPLICATION_END))
        {
            return;
        }
        else if(((management_class == (guint8)0x00) || (management_class == (guint8)0x02))
            || ((management_class >= (guint8)0x50) && (management_class <= (guint8)0x80))
            || ((management_class >= (guint8)0x82)))
        {
            return;
        }
        else /* we have a normal management_class */
        {
            parse_MAD_Common(NULL, tvb, &offset, &MadData);
            label_SUBM_Method(NULL, &MadData, pinfo);
            label_SUBM_Attribute(NULL, &MadData, pinfo);
        }
    }

    return;
}

/* Protocol Registration */
void proto_register_infiniband(void)
{
    /* Field dissector structures.
    * For reserved fields, reservedX denotes the reserved field is X bits in length.
    * e.g. reserved2 is a reserved field 2 bits in length.
    * The third parameter is a filter string associated for this field.
    * So for instance, to filter packets for a given virtual lane,
    * The filter (infiniband.LRH.vl == 3) or something similar would be used. */

    /* XXX: ToDo: Verify against Infiniband 1.2.1 Specification                           */
    /*            Fields verified/corrected: Those after comment "XX: All following ..."  */

    static hf_register_info hf[] = {    
        /* Local Route Header (LRH) */
        { &hf_infiniband_LRH, {
                "Local Route Header", "infiniband.lrh",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_virtual_lane, {
                "Virtual Lane", "infiniband.lrh.vl",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_link_version, {
                "Link Version", "infiniband.lrh.lver",
                FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_service_level, {
                "Service Level", "infiniband.lrh.sl",
                FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_reserved2, {
                "Reserved (2 bits)", "infiniband.lrh.reserved2",
                FT_UINT8, BASE_DEC, NULL, 0x0C, NULL, HFILL}
        },
        { &hf_infiniband_link_next_header, {
                "Link Next Header", "infiniband.lrh.lnh",
                FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
        },
        { &hf_infiniband_destination_local_id, {
                "Destination Local ID", "infiniband.lrh.dlid",
                FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved5, {
                "Reserved (5 bits)", "infiniband.lrh.reserved5",
                FT_UINT16, BASE_DEC, NULL, 0xF800, NULL, HFILL}
        },
        { &hf_infiniband_packet_length, {
                "Packet Length", "infiniband.lrh.pktlen",
                FT_UINT16, BASE_DEC, NULL, 0x07FF, NULL, HFILL}
        },
        { &hf_infiniband_source_local_id, {
                "Source Local ID", "infiniband.lrh.slid",
                FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* Global Route Header (GRH) */
        { &hf_infiniband_GRH, {
                "Global Route Header", "infiniband.grh",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ip_version, {
                "IP Version", "infiniband.grh.ipver",
                FT_UINT8, BASE_DEC, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_traffic_class, {
                "Traffic Class", "infiniband.grh.tclass",
                FT_UINT16, BASE_DEC, NULL, 0x0FF0, NULL, HFILL}
        },
        { &hf_infiniband_flow_label, {
                "Flow Label", "infiniband.grh.flowlabel",
                FT_UINT32, BASE_DEC, NULL, 0x000FFFFF, NULL, HFILL}
        },
        { &hf_infiniband_payload_length, {
                "Payload Length", "infiniband.grh.paylen",
                FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_next_header, {
                "Next Header", "infiniband.grh.nxthdr",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_hop_limit, {
                "Hop Limit", "infiniband.grh.hoplmt",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_source_gid, {
                "Source GID", "infiniband.grh.sgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_destination_gid, {
                "Destination GID", "infiniband.grh.dgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        
        /* Base Transport Header (BTH) */
        { &hf_infiniband_BTH, {
                "Base Transport Header", "infiniband.bth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_opcode, {
                "Opcode", "infiniband.bth.opcode",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_solicited_event, {
                "Solicited Event", "infiniband.bth.se",
                FT_BOOLEAN, 8, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_migreq, {
                "MigReq", "infiniband.bth.m",
                FT_BOOLEAN, 8, NULL, 0x40, NULL, HFILL}
        },
        { &hf_infiniband_pad_count, {
                "Pad Count", "infiniband.bth.padcnt",
                FT_UINT8, BASE_DEC, NULL, 0x30, NULL, HFILL}
        },
        { &hf_infiniband_transport_header_version, {
                "Header Version", "infiniband.bth.tver",
                FT_UINT8, BASE_DEC, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_partition_key, {
                "Partition Key", "infiniband.bth.p_key",
                FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved8, {
                "Reserved (8 bits)", "infiniband.bth.reserved8",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_destination_qp, {
                "Destination Queue Pair", "infiniband.bth.destqp",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_acknowledge_request, {
                "Acknowledge Request", "infiniband.bth.a",
                FT_BOOLEAN, 8, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_reserved7, {
                "Reserved (7 bits)", "infiniband.bth.reserved7",
                FT_UINT8, BASE_DEC, NULL, 0x7F, NULL, HFILL}
        },
        { &hf_infiniband_packet_sequence_number, {
                "Packet Sequence Number", "infiniband.bth.psn",
                FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* Raw Header (RWH) */
        { &hf_infiniband_RWH, {
                "Raw Header", "infiniband.rwh",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved16_RWH, {
                "Reserved (16 bits)", "infiniband.rwh.reserved",
                FT_UINT16, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_etype, {
                "Ethertype", "infiniband.rwh.etype",
                FT_UINT16, BASE_HEX, NULL /*VALS(etype_vals)*/, 0x0, "Type", HFILL }
        },

        /* Reliable Datagram Extended Transport Header (RDETH) */
        { &hf_infiniband_RDETH, {
                "Reliable Datagram Extended Transport Header", "infiniband.rdeth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved8_RDETH, {
                "Reserved (8 bits)", "infiniband.rdeth.reserved8",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ee_context, {
                "E2E Context", "infiniband.rdeth.eecnxt",
                FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* Datagram Extended Transport Header (DETH) */
        { &hf_infiniband_DETH, {
                "Datagram Extended Transport Header", "infiniband.deth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_queue_key, {
                "Queue Key", "infiniband.deth.q_key",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved8_DETH, {
                "Reserved (8 bits)", "infiniband.deth.reserved8",
                FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_source_qp, {
                "Source Queue Pair", "infiniband.deth.srcqp",
                FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* RDMA Extended Transport Header (RETH) */
        { &hf_infiniband_RETH, {
                "RDMA Extended Transport Header", "infiniband.reth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_virtual_address, {
                "Virtual Address", "infiniband.reth.va",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_remote_key, {
                "Remote Key", "infiniband.reth.r_key",
                FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_dma_length, {
                "DMA Length", "infiniband.reth.dmalen",
                FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* Atomic Extended Transport Header (AtomicETH) */
        { &hf_infiniband_AtomicETH, {
                "Atomic Extended Transport Header", "infiniband.atomiceth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#if 0
        { &hf_infiniband_virtual_address_AtomicETH, {
                "Virtual Address", "infiniband.atomiceth.va",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_remote_key_AtomicETH, {
                "Remote Key", "infiniband.atomiceth.r_key",
                FT_UINT32, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_swap_or_add_data, {
                "Swap (Or Add) Data", "infiniband.atomiceth.swapdt",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_compare_data, {
                "Compare Data", "infiniband.atomiceth.cmpdt",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* ACK Extended Transport Header (AETH) */
        { &hf_infiniband_AETH, {
                "ACK Extended Transport Header", "infiniband.aeth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_syndrome, {
                "Syndrome", "infiniband.aeth.syndrome",
                FT_UINT8, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_message_sequence_number, {
                "Message Sequence Number", "infiniband.aeth.msn",
                FT_UINT24, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },
        
        /* Atomic ACK Extended Transport Header (AtomicAckETH) */
        { &hf_infiniband_AtomicAckETH, {
                "Atomic ACK Extended Transport Header", "infiniband.atomicacketh",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_original_remote_data, {
                "Original Remote Data", "infiniband.atomicacketh.origremdt",
                FT_UINT64, BASE_DEC, NULL, 0x0, NULL, HFILL}
        },

        /* Immediate Extended Transport Header (ImmDT) */
        { &hf_infiniband_IMMDT, {
                "Immediate Data", "infiniband.immdt",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* Invalidate Extended Transport Header (IETH) */
        { &hf_infiniband_IETH, {
                "RKey", "infiniband.ieth",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* Payload */
        { &hf_infiniband_payload, {
                "Payload", "infiniband.payload",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_invariant_crc, {
                "Invariant CRC", "infiniband.invariant.crc",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_variant_crc, {
                "Variant CRC", "infiniband.variant.crc",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_raw_data, {
                "Raw Data", "infiniband.rawdata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        /* Unknown or Vendor Specific */
        { &hf_infiniband_vendor, {
                "Unknown/Vendor Specific Data", "infiniband.vendor",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* MAD Base Header */
        { &hf_infiniband_MAD, {
                "MAD (Management Datagram) Common Header", "infiniband.mad",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_base_version, {
                "Base Version", "infiniband.mad.baseversion",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_mgmt_class, {
                "Management Class", "infiniband.mad.mgmtclass",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_class_version, {
                "Class Version", "infiniband.mad.classversion",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
#if 0
        { &hf_infiniband_reserved1, {
                "Reserved", "infiniband.mad.reserved1",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
#endif
        { &hf_infiniband_method, {
                "Method", "infiniband.mad.method",
                FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
        },
        { &hf_infiniband_status, {
                "Status", "infiniband.mad.status",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_class_specific, {
                "Class Specific", "infiniband.mad.classspecific",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_transaction_id, {
                "Transaction ID", "infiniband.mad.transactionid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_attribute_id, {
                "Attribute ID", "infiniband.mad.attributeid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved16, {
                "Reserved", "infiniband.mad.reserved16",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_attribute_modifier, {
                "Attribute Modifier", "infiniband.mad.attributemodifier",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_data, {
                "MAD Data Payload", "infiniband.mad.data",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* RMPP Header */
        { &hf_infiniband_RMPP, {
                "RMPP (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_version, {
                "RMPP Type", "infiniband.rmpp.rmppversion",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_type, {
                "RMPP Type", "infiniband.rmpp.rmpptype",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_r_resp_time, {
                "R Resp Time", "infiniband.rmpp.rresptime",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_flags, {
                "RMPP Flags", "infiniband.rmpp.rmppflags",
                FT_UINT8, BASE_HEX, VALS(RMPP_Flags), 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_status, {
                "RMPP Status", "infiniband.rmpp.rmppstatus",
                FT_UINT8, BASE_HEX, VALS(RMPP_Status), 0x0, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_data1, {
                "RMPP Data 1", "infiniband.rmpp.data1",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_rmpp_data2, {
                "RMPP Data 2", "infiniband.rmpp.data2",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

    /* RMPP Data */
#if 0
        { &hf_infiniband_RMPP_DATA, {
                "RMPP Data (Reliable Multi-Packet Transaction Protocol)", "infiniband.rmpp.data",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_segment_number, {
                "Segment Number", "infiniband.rmpp.segmentnumber",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_payload_length32, {
                "Payload Length", "infiniband.rmpp.payloadlength",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_transferred_data, {
                "Transferred Data", "infiniband.rmpp.transferreddata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* RMPP ACK */
        { &hf_infiniband_new_window_last, {
                "New Window Last", "infiniband.rmpp.newwindowlast",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved220, {
                "Segment Number", "infiniband.rmpp.reserved220",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* RMPP ABORT/STOP */
        { &hf_infiniband_optional_extended_error_data, {
                "Optional Extended Error Data", "infiniband.rmpp.extendederrordata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* SMP Data (LID Routed) */
        { &hf_infiniband_SMP_LID, {
                "Subnet Management Packet (LID Routed)", "infiniband.smplid",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_m_key, {
                "M_Key", "infiniband.smplid.mkey",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_smp_data, {
                "SMP Data", "infiniband.smplid.smpdata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved1024, {
                "Reserved (1024 bits)", "infiniband.smplid.reserved1024",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved256, {
                "Reserved (256 bits)", "infiniband.smplid.reserved256",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

    /* XX: All following verified/corrected against Infiniband 1.2.1 Specification */
        /* SMP Data Directed Route */
        { &hf_infiniband_SMP_DIRECTED, {
                "Subnet Management Packet (Directed Route)", "infiniband.smpdirected",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_smp_status, {
                "Status", "infiniband.smpdirected.smpstatus",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_hop_pointer, {
                "Hop Pointer", "infiniband.smpdirected.hoppointer",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_hop_count, {
                "Hop Count", "infiniband.smpdirected.hopcount",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_dr_slid, {
                "DrSLID", "infiniband.smpdirected.drslid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_dr_dlid, {
                "DrDLID", "infiniband.smpdirected.drdlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_reserved28, {
                "Reserved (224 bits)", "infiniband.smpdirected.reserved28",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_d, {
                "D (Direction Bit)", "infiniband.smpdirected.d",
                FT_UINT64, BASE_HEX, NULL, 0x8000, NULL, HFILL}
        },
        { &hf_infiniband_initial_path, {
                "Initial Path", "infiniband.smpdirected.initialpath",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_return_path, {
                "Return Path", "infiniband.smpdirected.returnpath",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* SA MAD Header */
        { &hf_infiniband_SA, {
                "SA Packet (Subnet Administration)", "infiniband.sa.drdlid",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_sm_key, {
                "SM_Key (Verification Key)", "infiniband.sa.smkey",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_attribute_offset, {
                "Attribute Offset", "infiniband.sa.attributeoffset",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_component_mask, {
                "Component Mask", "infiniband.sa.componentmask",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_subnet_admin_data, {
                "Subnet Admin Data", "infiniband.sa.subnetadmindata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* NodeDescription */
        { &hf_infiniband_NodeDescription_NodeString, {
                "NodeString", "infiniband.nodedescription.nodestring",
                FT_STRING, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* NodeInfo */
        { &hf_infiniband_NodeInfo_BaseVersion, {
                "BaseVersion", "infiniband.nodeinfo.baseversion",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_ClassVersion, {
                "ClassVersion", "infiniband.nodeinfo.classversion",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_NodeType, {
                "NodeType", "infiniband.nodeinfo.nodetype",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_NumPorts, {
                "NumPorts", "infiniband.nodeinfo.numports",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_SystemImageGUID, {
                "SystemImageGUID", "infiniband.nodeinfo.systemimageguid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_NodeGUID, {
                "NodeGUID", "infiniband.nodeinfo.nodeguid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_PortGUID, {
                "PortGUID", "infiniband.nodeinfo.portguid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_PartitionCap, {
                "PartitionCap", "infiniband.nodeinfo.partitioncap",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_DeviceID, {
                "DeviceID", "infiniband.nodeinfo.deviceid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_Revision, {
                "Revision", "infiniband.nodeinfo.revision",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_LocalPortNum, {
                "LocalPortNum", "infiniband.nodeinfo.localportnum",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_NodeInfo_VendorID, {
                "VendorID", "infiniband.nodeinfo.vendorid",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* SwitchInfo */
        { &hf_infiniband_SwitchInfo_LinearFDBCap, {
                "LinearFDBCap", "infiniband.switchinfo.linearfdbcap",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_RandomFDBCap, {
                "RandomFDBCap", "infiniband.switchinfo.randomfdbcap",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_MulticastFDBCap, {
                "MulticastFDBCap", "infiniband.switchinfo.multicastfdbcap",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_LinearFDBTop, {
                "LinearFDBTop", "infiniband.switchinfo.linearfdbtop",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_DefaultPort, {
                "DefaultPort", "infiniband.switchinfo.defaultport",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_DefaultMulticastPrimaryPort, {
                "DefaultMulticastPrimaryPort", "infiniband.switchinfo.defaultmulticastprimaryport",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_DefaultMulticastNotPrimaryPort, {
                "DefaultMulticastNotPrimaryPort", "infiniband.switchinfo.defaultmulticastnotprimaryport",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_LifeTimeValue, {
                "LifeTimeValue", "infiniband.switchinfo.lifetimevalue",
                FT_UINT8, BASE_HEX, NULL, 0xF8, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_PortStateChange, {
                "PortStateChange", "infiniband.switchinfo.portstatechange",
                FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_OptimizedSLtoVLMappingProgramming, {
                "OptimizedSLtoVLMappingProgramming", "infiniband.switchinfo.optimizedsltovlmappingprogramming",
                FT_UINT8, BASE_HEX, NULL, 0x03, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_LIDsPerPort, {
                "LIDsPerPort", "infiniband.switchinfo.lidsperport",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_PartitionEnforcementCap, {
                "PartitionEnforcementCap", "infiniband.switchinfo.partitionenforcementcap",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_InboundEnforcementCap, {
                "InboundEnforcementCap", "infiniband.switchinfo.inboundenforcementcap",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_OutboundEnforcementCap, {
                "OutboundEnforcementCap", "infiniband.switchinfo.outboundenforcementcap",
                FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_FilterRawInboundCap, {
                "FilterRawInboundCap", "infiniband.switchinfo.filterrawinboundcap",
                FT_UINT8, BASE_HEX, NULL, 0x20, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_FilterRawOutboundCap, {
                "FilterRawOutboundCap", "infiniband.switchinfo.filterrawoutboundcap",
                FT_UINT8, BASE_HEX, NULL, 0x10, NULL, HFILL}
        },
        { &hf_infiniband_SwitchInfo_EnhancedPortZero, {
                "EnhancedPortZero", "infiniband.switchinfo.enhancedportzero",
                FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
        },

        /* GUIDInfo */
#if 0
        { &hf_infiniband_GUIDInfo_GUIDBlock, {
                "GUIDBlock", "infiniband.switchinfo.guidblock",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_GUIDInfo_GUID, {
                "GUID", "infiniband.switchinfo.guid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* PortInfo */
        { &hf_infiniband_PortInfo_M_Key, {
                "M_Key", "infiniband.portinfo.m_key",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_GidPrefix, {
                "GidPrefix", "infiniband.portinfo.guid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LID, {
                "LID", "infiniband.portinfo.lid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_MasterSMLID, {
                "MasterSMLID", "infiniband.portinfo.mastersmlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask, {
                "CapabilityMask", "infiniband.portinfo.capabilitymask",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        
        /* Capability Mask Flags */
        { &hf_infiniband_PortInfo_CapabilityMask_SM, {
                "SM", "infiniband.portinfo.capabilitymask.issm",
                FT_UINT32, BASE_HEX, NULL, 0x00000002, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_NoticeSupported, {
                "NoticeSupported", "infiniband.portinfo.capabilitymask.noticesupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000004, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_TrapSupported, {
                "TrapSupported", "infiniband.portinfo.capabilitymask.trapsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000008, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_OptionalPDSupported, {
                "OptionalPDSupported", "infiniband.portinfo.capabilitymask.optionalpdsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000010, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_AutomaticMigrationSupported, {
                "AutomaticMigrationSupported", "infiniband.portinfo.capabilitymask.automaticmigrationsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000020, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_SLMappingSupported, {
                "SLMappingSupported", "infiniband.portinfo.capabilitymask.slmappingsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000040, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_MKeyNVRAM, {
                "MKeyNVRAM", "infiniband.portinfo.capabilitymask.mkeynvram",
                FT_UINT32, BASE_HEX, NULL, 0x00000080, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_PKeyNVRAM, {
                "PKeyNVRAM", "infiniband.portinfo.capabilitymask.pkeynvram",
                FT_UINT32, BASE_HEX, NULL, 0x00000100, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_LEDInfoSupported, {
                "LEDInfoSupported", "infiniband.portinfo.capabilitymask.ledinfosupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000200, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_SMdisabled, {
                "SMdisabled", "infiniband.portinfo.capabilitymask.smdisabled",
                FT_UINT32, BASE_HEX, NULL, 0x00000400, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_SystemImageGUIDSupported, {
                "SystemImageGUIDSupported", "infiniband.portinfo.capabilitymask.systemimageguidsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00000800, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_PKeySwitchExternalPortTrapSupported, {
                "PKeySwitchExternalPortTrapSupported", "infiniband.portinfo.capabilitymask.pkeyswitchexternalporttrapsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00001000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_CommunicationsManagementSupported, {
                "CommunicationsManagementSupported", "infiniband.portinfo.capabilitymask.communicationsmanagementsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00010000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_SNMPTunnelingSupported, {
                "SNMPTunnelingSupported", "infiniband.portinfo.capabilitymask.snmptunnelingsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00020000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_ReinitSupported, {
                "ReinitSupported", "infiniband.portinfo.capabilitymask.reinitsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00040000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_DeviceManagementSupported, {
                "DeviceManagementSupported", "infiniband.portinfo.capabilitymask.devicemanagementsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00080000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_VendorClassSupported, {
                "VendorClassSupported", "infiniband.portinfo.capabilitymask.vendorclasssupported",
                FT_UINT32, BASE_HEX, NULL, 0x00100000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_DRNoticeSupported, {
                "DRNoticeSupported", "infiniband.portinfo.capabilitymask.drnoticesupported",
                FT_UINT32, BASE_HEX, NULL, 0x00200000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_CapabilityMaskNoticeSupported, {
                "CapabilityMaskNoticeSupported", "infiniband.portinfo.capabilitymask.capabilitymasknoticesupported",
                FT_UINT32, BASE_HEX, NULL, 0x00400000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_BootManagementSupported, {
                "BootManagementSupported", "infiniband.portinfo.capabilitymask.bootmanagementsupported",
                FT_UINT32, BASE_HEX, NULL, 0x00800000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_LinkRoundTripLatencySupported, {
                "LinkRoundTripLatencySupported", "infiniband.portinfo.capabilitymask.linkroundtriplatencysupported",
                FT_UINT32, BASE_HEX, NULL, 0x01000000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_ClientRegistrationSupported, {
                "ClientRegistrationSupported", "infiniband.portinfo.capabilitymask.clientregistrationsupported",
                FT_UINT32, BASE_HEX, NULL, 0x02000000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_OtherLocalChangesNoticeSupported, {
                "OtherLocalChangesNoticeSupported", "infiniband.portinfo.capabilitymask.otherlocalchangesnoticesupported",
                FT_UINT32, BASE_HEX, NULL, 0x04000000, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_CapabilityMask_LinkSpeedWIdthPairsTableSupported, {
                "LinkSpeedWIdthPairsTableSupported", "infiniband.portinfo.capabilitymask.linkspeedwidthpairstablesupported",
                FT_UINT32, BASE_HEX, NULL, 0x08000000, NULL, HFILL}
        },
        /* End Capability Mask Flags */

        /* PortInfo */
        { &hf_infiniband_PortInfo_DiagCode, {
                "DiagCode", "infiniband.portinfo.diagcode",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_M_KeyLeasePeriod, {
                "M_KeyLeasePeriod", "infiniband.portinfo.m_keyleaseperiod",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LocalPortNum, {
                "LocalPortNum", "infiniband.portinfo.localportnum",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkWidthEnabled, {
                "LinkWidthEnabled", "infiniband.portinfo.linkwidthenabled",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkWidthSupported, {
                "LinkWidthSupported", "infiniband.portinfo.linkwidthsupported",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkWidthActive, {
                "LinkWidthActive", "infiniband.portinfo.linkwidthactive",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkSpeedSupported, {
                "LinkSpeedSupported", "infiniband.portinfo.linkspeedsupported",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_PortState, {
                "PortState", "infiniband.portinfo.portstate",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_PortPhysicalState, {
                "PortPhysicalState", "infiniband.portinfo.portphysicalstate",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkDownDefaultState, {
                "LinkDownDefaultState", "infiniband.portinfo.linkdowndefaultstate",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_M_KeyProtectBits, {
                "M_KeyProtectBits", "infiniband.portinfo.m_keyprotectbits",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LMC, {
                "LMC", "infiniband.portinfo.lmc",
                FT_UINT8, BASE_HEX, NULL, 0x07, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkSpeedActive, {
                "LinkSpeedActive", "infiniband.portinfo.linkspeedactive",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkSpeedEnabled, {
                "LinkSpeedEnabled", "infiniband.portinfo.linkspeedenabled",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_NeighborMTU, {
                "NeighborMTU", "infiniband.portinfo.neighbormtu",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_MasterSMSL, {
                "MasterSMSL", "infiniband.portinfo.mastersmsl",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_VLCap, {
                "VLCap", "infiniband.portinfo.vlcap",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_InitType, {
                "InitType", "infiniband.portinfo.inittype",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_VLHighLimit, {
                "VLHighLimit", "infiniband.portinfo.vlhighlimit",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_VLArbitrationHighCap, {
                "VLArbitrationHighCap", "infiniband.portinfo.vlarbitrationhighcap",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_VLArbitrationLowCap, {
                "VLArbitrationLowCap", "infiniband.portinfo.vlarbitrationlowcap",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_InitTypeReply, {
                "InitTypeReply", "infiniband.portinfo.inittypereply",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_MTUCap, {
                "MTUCap", "infiniband.portinfo.mtucap",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_VLStallCount, {
                "VLStallCount", "infiniband.portinfo.vlstallcount",
                FT_UINT8, BASE_HEX, NULL, 0xE0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_HOQLife, {
                "HOQLife", "infiniband.portinfo.hoqlife",
                FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_OperationalVLs, {
                "OperationalVLs", "infiniband.portinfo.operationalvls",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_PartitionEnforcementInbound, {
                "PartitionEnforcementInbound", "infiniband.portinfo.partitionenforcementinbound",
                FT_UINT8, BASE_HEX, NULL, 0x08, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_PartitionEnforcementOutbound, {
                "PartitionEnforcementOutbound", "infiniband.portinfo.partitionenforcementoutbound",
                FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_FilterRawInbound, {
                "FilterRawInbound", "infiniband.portinfo.filterrawinbound",
                FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_FilterRawOutbound, {
                "FilterRawOutbound", "infiniband.portinfo.filterrawoutbound",
                FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_M_KeyViolations, {
                "M_KeyViolations", "infiniband.portinfo.m_keyviolations",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_P_KeyViolations, {
                "P_KeyViolations", "infiniband.portinfo.p_keyviolations",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_Q_KeyViolations, {
                "Q_KeyViolations", "infiniband.portinfo.q_keyviolations",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_GUIDCap, {
                "GUIDCap", "infiniband.portinfo.guidcap",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_ClientReregister, {
                "ClientReregister", "infiniband.portinfo.clientreregister",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_SubnetTimeOut, {
                "SubnetTimeOut", "infiniband.portinfo.subnettimeout",
                FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_RespTimeValue, {
                "RespTimeValue", "infiniband.portinfo.resptimevalue",
                FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LocalPhyErrors, {
                "LocalPhyErrors", "infiniband.portinfo.localphyerrors",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_OverrunErrors, {
                "OverrunErrors", "infiniband.portinfo.overrunerrors",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_MaxCreditHint, {
                "MaxCreditHint", "infiniband.portinfo.maxcredithint",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PortInfo_LinkRoundTripLatency, {
                "LinkRoundTripLatency", "infiniband.portinfo.linkroundtriplatency",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* P_KeyTable */
        { &hf_infiniband_P_KeyTable_P_KeyTableBlock, {
                "P_KeyTableBlock", "infiniband.p_keytable.p_keytableblock",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_P_KeyTable_MembershipType, {
                "MembershipType", "infiniband.p_keytable.membershiptype",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_P_KeyTable_P_KeyBase, {
                "P_KeyBase", "infiniband.p_keytable.p_keybase",
                FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
        },

        /* SLtoVLMappingTable */
        { &hf_infiniband_SLtoVLMappingTable_SLtoVL_HighBits, {
                "SL(x)toVL", "infiniband.sltovlmappingtable.sltovlhighbits",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_SLtoVLMappingTable_SLtoVL_LowBits, {
                "SL(x)toVL", "infiniband.sltovlmappingtable.sltovllowbits",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },

        /* VLArbitrationTable */
#if 0
        { &hf_infiniband_VLArbitrationTable_VLWeightPairs, {
                "VLWeightPairs", "infiniband.vlarbitrationtable.vlweightpairs",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_VLArbitrationTable_VL, {
                "VL", "infiniband.vlarbitrationtable.vl",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_VLArbitrationTable_Weight, {
                "Weight", "infiniband.vlarbitrationtable.weight",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* LinearForwardingTable */
#if 0
        { &hf_infiniband_LinearForwardingTable_LinearForwardingTableBlock, {
                "LinearForwardingTableBlock", "infiniband.linearforwardingtable.linearforwardingtableblock",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_LinearForwardingTable_Port, {
                "Port", "infiniband.linearforwardingtable.port",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* RandomForwardingTable */
#if 0
        { &hf_infiniband_RandomForwardingTable_RandomForwardingTableBlock, {
                "RandomForwardingTableBlock", "infiniband.randomforwardingtable.randomforwardingtableblock",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_RandomForwardingTable_LID, {
                "LID", "infiniband.randomforwardingtable.lid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_RandomForwardingTable_Valid, {
                "Valid", "infiniband.randomforwardingtable.valid",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_RandomForwardingTable_LMC, {
                "LMC", "infiniband.randomforwardingtable.lmc",
                FT_UINT8, BASE_HEX, NULL, 0x70, NULL, HFILL}
        },
        { &hf_infiniband_RandomForwardingTable_Port, {
                "Port", "infiniband.randomforwardingtable.port",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* MulticastForwardingTable */
#if 0
        { &hf_infiniband_MulticastForwardingTable_MulticastForwardingTableBlock , {
                "MulticastForwardingTableBlock", "infiniband.multicastforwardingtable.multicastforwardingtableblock",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif
        { &hf_infiniband_MulticastForwardingTable_PortMask, {
                "PortMask", "infiniband.multicastforwardingtable.portmask",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* SMInfo */
        { &hf_infiniband_SMInfo_GUID, {
                "GUID", "infiniband.sminfo.guid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SMInfo_SM_Key, {
                "SM_Key", "infiniband.sminfo.sm_key",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SMInfo_ActCount, {
                "ActCount", "infiniband.sminfo.actcount",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SMInfo_Priority, {
                "Priority", "infiniband.sminfo.priority",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_SMInfo_SMState, {
                "SMState", "infiniband.sminfo.smstate",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },

        /* VendorDiag */
        { &hf_infiniband_VendorDiag_NextIndex, {
                "NextIndex", "infiniband.vendordiag.nextindex",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_VendorDiag_DiagData, {
                "DiagData", "infiniband.vendordiag.diagdata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* LedInfo */
        { &hf_infiniband_LedInfo_LedMask, {
                "LedMask", "infiniband.ledinfo.ledmask",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },  

        /* LinkSpeedWidthPairsTable */
        { &hf_infiniband_LinkSpeedWidthPairsTable_NumTables, {
                "NumTables", "infiniband.linkspeedwidthpairstable.numtables",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_LinkSpeedWidthPairsTable_PortMask, {
                "PortMask", "infiniband.linkspeedwidthpairstable.portmask",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },  
        { &hf_infiniband_LinkSpeedWidthPairsTable_SpeedTwoFive, {
                "Speed 2.5 Gbps", "infiniband.linkspeedwidthpairstable.speedtwofive",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },  
        { &hf_infiniband_LinkSpeedWidthPairsTable_SpeedFive, {
                "Speed 5 Gbps", "infiniband.linkspeedwidthpairstable.speedfive",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },  
        { &hf_infiniband_LinkSpeedWidthPairsTable_SpeedTen, {
                "Speed 10 Gbps", "infiniband.linkspeedwidthpairstable.speedten",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },  

        /* NodeRecord */
        /* PortInfoRecord */
        /* SLtoVLMappingTableRecord */
        /* SwitchInfoRecord */
        /* LinearForwardingTableRecord */
        /* RandomForwardingTableRecord */
        /* MulticastForwardingTableRecord */
        /* VLArbitrationTableRecord */
        { &hf_infiniband_SA_LID, {
                "LID", "infiniband.sa.lid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_EndportLID, {
                "EndportLID", "infiniband.sa.endportlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_PortNum, {
                "PortNum", "infiniband.sa.portnum",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_InputPortNum , {
                "InputPortNum", "infiniband.sa.inputportnum",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_OutputPortNum, {
                "OutputPortNum", "infiniband.sa.outputportnum",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_BlockNum_EightBit, {
                "BlockNum_EightBit", "infiniband.sa.blocknum_eightbit",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_BlockNum_NineBit, {
                "BlockNum_NineBit", "infiniband.sa.blocknum_ninebit",
                FT_UINT16, BASE_HEX, NULL, 0x01FF, NULL, HFILL}
        },
        { &hf_infiniband_SA_BlockNum_SixteenBit, {
                "BlockNum_SixteenBit", "infiniband.sa.blocknum_sixteenbit",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_SA_Position, {
                "Position", "infiniband.sa.position",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
#if 0
        { &hf_infiniband_SA_Index, {
                "Index", "infiniband.sa.index",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
#endif

        /* InformInfoRecord */
        { &hf_infiniband_InformInfoRecord_SubscriberGID, {
                "SubscriberGID", "infiniband.informinforecord.subscribergid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfoRecord_Enum, {
                "Enum", "infiniband.informinforecord.enum",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* InformInfo */
        { &hf_infiniband_InformInfo_GID, {
                "GID", "infiniband.informinfo.gid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_LIDRangeBegin, {
                "LIDRangeBegin", "infiniband.informinfo.lidrangebegin",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_LIDRangeEnd, {
                "LIDRangeEnd", "infiniband.informinfo.lidrangeend",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_IsGeneric, {
                "IsGeneric", "infiniband.informinfo.isgeneric",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_Subscribe, {
                "Subscribe", "infiniband.informinfo.subscribe",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_Type, {
                "Type", "infiniband.informinfo.type",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_TrapNumberDeviceID, {
                "TrapNumberDeviceID", "infiniband.informinfo.trapnumberdeviceid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_QPN, {
                "QPN", "infiniband.informinfo.qpn",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_RespTimeValue, {
                "RespTimeValue", "infiniband.informinfo.resptimevalue",
                FT_UINT8, BASE_HEX, NULL, 0x1F, NULL, HFILL}
        },
        { &hf_infiniband_InformInfo_ProducerTypeVendorID, {
                "ProducerTypeVendorID", "infiniband.informinfo.producertypevendorid",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* LinkRecord */
        { &hf_infiniband_LinkRecord_FromLID, {
                "FromLID", "infiniband.linkrecord.fromlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_LinkRecord_FromPort, {
                "FromPort", "infiniband.linkrecord.fromport",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_LinkRecord_ToPort, {
                "ToPort", "infiniband.linkrecord.toport",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_LinkRecord_ToLID, {
                "ToLID", "infiniband.linkrecord.tolid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* ServiceRecord */
        { &hf_infiniband_ServiceRecord_ServiceID, {
                "ServiceID", "infiniband.linkrecord.serviceid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceGID, {
                "ServiceGID", "infiniband.linkrecord.servicegid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceP_Key, {
                "ServiceP_Key", "infiniband.linkrecord.servicep_key",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceLease, {
                "ServiceLease", "infiniband.linkrecord.servicelease",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceKey, {
                "ServiceKey", "infiniband.linkrecord.servicekey",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceName, {
                "ServiceName", "infiniband.linkrecord.servicename",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceRecord_ServiceData, {
                "ServiceData", "infiniband.linkrecord.servicedata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* ServiceAssociationRecord */
        { &hf_infiniband_ServiceAssociationRecord_ServiceKey, {
                "ServiceKey", "infiniband.serviceassociationrecord.servicekey",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_ServiceAssociationRecord_ServiceName, {
                "ServiceName", "infiniband.serviceassociationrecord.servicename",
                FT_STRING, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* PathRecord */
        { &hf_infiniband_PathRecord_DGID, {
                "DGID", "infiniband.pathrecord.dgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_SGID, {
                "SGID", "infiniband.pathrecord.sgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_DLID, {
                "DLID", "infiniband.pathrecord.dlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_SLID, {
                "SLID", "infiniband.pathrecord.slid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_RawTraffic, {
                "RawTraffic", "infiniband.pathrecord.rawtraffic",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_FlowLabel, {
                "FlowLabel", "infiniband.pathrecord.flowlabel",
                FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_HopLimit, {
                "HopLimit", "infiniband.pathrecord.hoplimit",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_TClass, {
                "TClass", "infiniband.pathrecord.tclass",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_Reversible, {
                "Reversible", "infiniband.pathrecord.reversible",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_NumbPath, {
                "NumbPath", "infiniband.pathrecord.numbpath",
                FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_P_Key, {
                "P_Key", "infiniband.pathrecord.p_key",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_SL, {
                "SL", "infiniband.pathrecord.sl",
                FT_UINT16, BASE_HEX, NULL, 0x000F, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_MTUSelector, {
                "MTUSelector", "infiniband.pathrecord.mtuselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_MTU, {
                "MTU", "infiniband.pathrecord.mtu",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_RateSelector, {
                "RateSelector", "infiniband.pathrecord.rateselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_Rate, {
                "Rate", "infiniband.pathrecord.rate",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_PacketLifeTimeSelector, {
                "PacketLifeTimeSelector", "infiniband.pathrecord.packetlifetimeselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_PacketLifeTime, {
                "PacketLifeTime", "infiniband.pathrecord.packetlifetime",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_PathRecord_Preference, {
                "Preference", "infiniband.pathrecord.preference",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* MCMemberRecord */
        { &hf_infiniband_MCMemberRecord_MGID, {
                "MGID", "infiniband.mcmemberrecord.mgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_PortGID, {
                "PortGID", "infiniband.mcmemberrecord.portgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_Q_Key, {
                "Q_Key", "infiniband.mcmemberrecord.q_key",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_MLID, {
                "MLID", "infiniband.mcmemberrecord.mlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_MTUSelector, {
                "MTUSelector", "infiniband.mcmemberrecord.mtuselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_MTU, {
                "MTU", "infiniband.mcmemberrecord.mtu",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_TClass, {
                "TClass", "infiniband.mcmemberrecord.tclass",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_P_Key, {
                "P_Key", "infiniband.mcmemberrecord.p_key",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_RateSelector, {
                "RateSelector", "infiniband.mcmemberrecord.rateselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_Rate, {
                "Rate", "infiniband.mcmemberrecord.rate",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_PacketLifeTimeSelector, {
                "PacketLifeTimeSelector", "infiniband.mcmemberrecord.packetlifetimeselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_PacketLifeTime, {
                "PacketLifeTime", "infiniband.mcmemberrecord.packetlifetime",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_SL, {
                "SL", "infiniband.mcmemberrecord.sl",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_FlowLabel, {
                "FlowLabel", "infiniband.mcmemberrecord.flowlabel",
                FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_HopLimit, {
                "HopLimit", "infiniband.mcmemberrecord.hoplimit",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_Scope, {
                "Scope", "infiniband.mcmemberrecord.scope",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_JoinState, {
                "JoinState", "infiniband.mcmemberrecord.joinstate",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_MCMemberRecord_ProxyJoin, {
                "ProxyJoin", "infiniband.mcmemberrecord.proxyjoin",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },

        /* MultiPathRecord */
        { &hf_infiniband_MultiPathRecord_RawTraffic, {
                "RawTraffic", "infiniband.multipathrecord.rawtraffic",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_FlowLabel, {
                "FlowLabel", "infiniband.multipathrecord.flowlabel",
                FT_UINT24, BASE_HEX, NULL, 0x0FFFFF, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_HopLimit, {
                "HopLimit", "infiniband.multipathrecord.hoplimit",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_TClass, {
                "TClass", "infiniband.multipathrecord.tclass",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_Reversible, {
                "Reversible", "infiniband.multipathrecord.reversible",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_NumbPath, {
                "NumbPath", "infiniband.multipathrecord.numbpath",
                FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_P_Key, {
                "P_Key", "infiniband.multipathrecord.p_key",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_SL, {
                "SL", "infiniband.multipathrecord.sl",
                FT_UINT8, BASE_HEX, NULL, 0x0F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_MTUSelector, {
                "MTUSelector", "infiniband.multipathrecord.mtuselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_MTU, {
                "MTU", "infiniband.multipathrecord.mtu",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_RateSelector, {
                "RateSelector", "infiniband.multipathrecord.rateselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_Rate, {
                "Rate", "infiniband.multipathrecord.rate",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_PacketLifeTimeSelector, {
                "PacketLifeTimeSelector", "infiniband.multipathrecord.packetlifetimeselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_PacketLifeTime, {
                "PacketLifeTime", "infiniband.multipathrecord.packetlifetime",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_IndependenceSelector, {
                "IndependenceSelector", "infiniband.multipathrecord.independenceselector",
                FT_UINT8, BASE_HEX, NULL, 0xC0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_GIDScope, {
                "GIDScope", "infiniband.multipathrecord.gidscope",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_SGIDCount, {
                "SGIDCount", "infiniband.multipathrecord.sgidcount",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_DGIDCount, {
                "DGIDCount", "infiniband.multipathrecord.dgidcount",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_MultiPathRecord_SDGID, {
                "SDGID", "infiniband.multipathrecord.sdgid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* Notice */
        { &hf_infiniband_Notice_IsGeneric, {
                "IsGeneric", "infiniband.notice.isgeneric",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_Notice_Type, {
                "Type", "infiniband.notice.type",
                FT_UINT8, BASE_HEX, NULL, 0x7F, NULL, HFILL}
        },
        { &hf_infiniband_Notice_ProducerTypeVendorID, {
                "ProducerTypeVendorID", "infiniband.notice.producertypevendorid",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Notice_TrapNumberDeviceID, {
                "TrapNumberDeviceID", "infiniband.notice.trapnumberdeviceid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Notice_IssuerLID, {
                "IssuerLID", "infiniband.notice.issuerlid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Notice_NoticeToggle, {
                "NoticeToggle", "infiniband.notice.noticetoggle",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_Notice_NoticeCount, {
                "NoticeCount", "infiniband.notice.noticecount",
                FT_UINT16, BASE_HEX, NULL, 0x7FFF, NULL, HFILL}
        },
        { &hf_infiniband_Notice_DataDetails, {
                "DataDetails", "infiniband.notice.datadetails",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#if 0
        { &hf_infiniband_Notice_IssuerGID, {
                "IssuerGID", "infiniband.notice.issuergid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Notice_ClassTrapSpecificData, {
                "ClassTrapSpecificData", "infiniband.notice.classtrapspecificdata",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif

        /* Traps 64,65,66,67 */
        { &hf_infiniband_Trap_GIDADDR, {
                "GIDADDR", "infiniband.trap.gidaddr",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        /* Traps 68,69 */
        { &hf_infiniband_Trap_COMP_MASK, {
                "COMP_MASK", "infiniband.trap.comp_mask",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_WAIT_FOR_REPATH, {
                "WAIT_FOR_REPATH", "infiniband.trap.wait_for_repath",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
#if 0
        { &hf_infiniband_Trap_PATH_REC, {
                "PATH_REC", "infiniband.trap.path_rec",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
#endif

        /* Trap 128 */
        { &hf_infiniband_Trap_LIDADDR, {
                "LIDADDR", "infiniband.trap.lidaddr",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* Trap 129, 130, 131 */
        { &hf_infiniband_Trap_PORTNO, {
                "PORTNO", "infiniband.trap.portno",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* Trap 144 */
        { &hf_infiniband_Trap_OtherLocalChanges, {
                "OtherLocalChanges", "infiniband.trap.otherlocalchanges",
                FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
        },
        { &hf_infiniband_Trap_CAPABILITYMASK, {
                "CAPABILITYMASK", "infiniband.trap.capabilitymask",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_LinkSpeecEnabledChange, {
                "LinkSpeecEnabledChange", "infiniband.trap.linkspeecenabledchange",
                FT_UINT8, BASE_HEX, NULL, 0x04, NULL, HFILL}
        },
        { &hf_infiniband_Trap_LinkWidthEnabledChange, {
                "LinkWidthEnabledChange", "infiniband.trap.linkwidthenabledchange",
                FT_UINT8, BASE_HEX, NULL, 0x02, NULL, HFILL}
        },
        { &hf_infiniband_Trap_NodeDescriptionChange, {
                "NodeDescriptionChange", "infiniband.trap.nodedescriptionchange",
                FT_UINT8, BASE_HEX, NULL, 0x01, NULL, HFILL}
        },

        /* Trap 145 */
        { &hf_infiniband_Trap_SYSTEMIMAGEGUID, {
                "SYSTEMIMAGEGUID", "infiniband.trap.systemimageguid",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },

        /* Trap 256 */
        { &hf_infiniband_Trap_DRSLID, {
                "DRSLID", "infiniband.trap.drslid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_METHOD, {
                "METHOD", "infiniband.trap.method",
                FT_UINT8, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_ATTRIBUTEID, {
                "ATTRIBUTEID", "infiniband.trap.attributeid",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_ATTRIBUTEMODIFIER, {
                "ATTRIBUTEMODIFIER", "infiniband.trap.attributemodifier",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_MKEY, {
                "MKEY", "infiniband.trap.mkey",
                FT_UINT64, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_DRNotice, {
                "DRNotice", "infiniband.trap.drnotice",
                FT_UINT8, BASE_HEX, NULL, 0x80, NULL, HFILL}
        },
        { &hf_infiniband_Trap_DRPathTruncated, {
                "DRPathTruncated", "infiniband.trap.drpathtruncated",
                FT_UINT8, BASE_HEX, NULL, 0x40, NULL, HFILL}
        },
        { &hf_infiniband_Trap_DRHopCount, {
                "DRHopCount", "infiniband.trap.drhopcount",
                FT_UINT8, BASE_HEX, NULL, 0x3F, NULL, HFILL}
        },
        { &hf_infiniband_Trap_DRNoticeReturnPath, {
                "DRNoticeReturnPath", "infiniband.trap.drnoticereturnpath",
                FT_BYTES, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* Trap 257, 258 */
        { &hf_infiniband_Trap_LIDADDR1, {
                "LIDADDR1", "infiniband.trap.lidaddr1",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_LIDADDR2, {
                "LIDADDR2", "infiniband.trap.lidaddr2",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_KEY, {
                "KEY", "infiniband.trap.key",
                FT_UINT32, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_SL, {
                "SL", "infiniband.trap.sl",
                FT_UINT8, BASE_HEX, NULL, 0xF0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_QP1, {
                "QP1", "infiniband.trap.qp1",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_QP2, {
                "QP2", "infiniband.trap.qp2",
                FT_UINT24, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_GIDADDR1, {
                "GIDADDR1", "infiniband.trap.gidaddr1",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_GIDADDR2, {
                "GIDADDR2", "infiniband.trap.gidaddr2",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },

        /* Trap 259 */
        { &hf_infiniband_Trap_DataValid, {
                "DataValid", "infiniband.trap.datavalid",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_PKEY, {
                "PKEY", "infiniband.trap.pkey",
                FT_UINT16, BASE_HEX, NULL, 0x0, NULL, HFILL}
        },
        { &hf_infiniband_Trap_SWLIDADDR, {
                "SWLIDADDR", "infiniband.trap.swlidaddr",
                FT_IPv6, BASE_NONE, NULL, 0x0, NULL, HFILL}
        }
    };

    /* Array to hold expansion options between dissections */
    static gint *ett[] = {
    /*  &ett_infiniband,       */
        &ett_all_headers,
        &ett_lrh,
        &ett_grh,
        &ett_bth,
        &ett_rwh,
        &ett_rawdata,
        &ett_rdeth,
        &ett_deth,
        &ett_reth,
        &ett_atomiceth,
        &ett_aeth,
        &ett_atomicacketh,
        &ett_immdt,
        &ett_ieth,
        &ett_payload,
        &ett_vendor,
        &ett_subn_lid_routed,
        &ett_subn_directed_route,
        &ett_subnadmin,
        &ett_mad,
        &ett_rmpp,
        &ett_subm_attribute,
        &ett_suba_attribute,
        &ett_datadetails,
        &ett_noticestraps,
    /*  &ett_nodedesc,         */
    /*  &ett_nodeinfo,         */
    /*  &ett_switchinfo,       */
    /*  &ett_guidinfo,         */
    /*  &ett_portinfo,         */
        &ett_portinfo_capmask,
        &ett_pkeytable,
        &ett_sltovlmapping,
        &ett_vlarbitrationtable,
        &ett_linearforwardingtable,
        &ett_randomforwardingtable,
        &ett_multicastforwardingtable,
        &ett_sminfo,
        &ett_vendordiag,
        &ett_ledinfo,
        &ett_linkspeedwidthpairs,
        &ett_informinfo,
        &ett_linkrecord,
        &ett_servicerecord,
        &ett_pathrecord,
        &ett_mcmemberrecord,
        &ett_tracerecord,
        &ett_multipathrecord,
        &ett_serviceassocrecord
    };

    proto_infiniband = proto_register_protocol("InfiniBand", "InfiniBand", "infiniband");
    register_dissector("infiniband", dissect_infiniband, proto_infiniband);

    proto_register_field_array(proto_infiniband, hf, array_length(hf));
    proto_register_subtree_array(ett, array_length(ett));

}

/* Reg Handoff.  Register dissectors we'll need for IPoIB */
void proto_reg_handoff_infiniband(void)
{
    ipv6_handle = find_dissector("ipv6");
    data_handle = find_dissector("data");
    ethertype_dissector_table = find_dissector_table("ethertype");
}